NMR Restraints Grid

Result table
 (Save to zip file containing files for each block)

image mrblock_id pdb_id bmrb_id cing stage position program type
549746 2lug 18520 cing 1-original 1 NMRPipe dihedral angle


REMARK TALOS+ Protein Backbone Torsion Angle Prediction Table
REMARK  Prediction Summary for Chemical Shift Input myshifts.tab
REMARK 
REMARK  PHI is the predicted torsion angle C(i-1) N(i)  CA(i) C(i)   (degrees).
REMARK  PSI is the predicted torsion angle N(i)   CA(i) C(i)  N(i+1) (degrees).
REMARK 
REMARK  DPHI and DPSI are the estimated standard deviations of the
REMARK  prediction errors in PHI and PSI (degrees).
REMARK 
REMARK  DIST is the TALOS+ database matching score.
REMARK 
REMARK  S2 is the Wishart RCI chemical shift order parameter,
REMARK  JACS, 127(43), 14970-14971.
REMARK 
REMARK  COUNT is the number of database triplets used to form
REMARK  the torsion angle predictions.
REMARK 
REMARK  CLASS is the classification of the prediction result:
REMARK    None: no torsion prediction was made.
REMARK 
REMARK    Good: majority consensus in database matches;
REMARK          prediction is likely to be good.
REMARK 
REMARK    Warn: no consensus in database matches, do not use prediction.
REMARK 
REMARK    Dyn:  RCI S2 value indicates that residue has dynamic conformation.
REMARK 
REMARK Reference:
REMARK  Y. Shen, F. Delaglio, G. Cornilescu, and A. Bax:
REMARK  TALOS plus: A hybrid method for predicting protein
REMARK  torsion angles from NMR chemical shifts.
REMARK  J. Biomol. NMR 44, 213-223 (2009).
REMARK 
REMARK  TALOS+ Version 3.70F1 Rev 2012.029.12.03 TALOS_INFO

DATA FIRST_RESID 1
DATA SEQUENCE SQHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLS

VARS   RESID RESNAME PHI PSI DPHI DPSI DIST S2 COUNT CS_COUNT CLASS
FORMAT %4d %s %8.3f %8.3f %8.3f %8.3f %8.3f %5.3f %2d %2d %s

   1 S 9999.000 9999.000    0.000    0.000    0.000 0.000  0 10 None
   2 Q  -78.000  134.000   65.000   22.000   26.690 0.597 10 15 Dyn
   3 H  -56.000  128.000   50.000   28.000   33.830 0.617 10 13 Dyn
   4 G  112.315  158.653  108.752   33.729   36.539 0.591  9 13 Dyn
   5 R  -82.977  125.777   62.704   26.835   34.506 0.577 10 13 Dyn
   6 T  -59.000  134.000   75.000   41.000   31.490 0.605 10 15 Dyn
   7 Q  -71.000  125.000   70.000   20.000   28.910 0.663  8 15 Dyn
   8 D  -70.000  134.000   63.000   20.000   27.650 0.742  9 15 Dyn
   9 E  -78.000  129.000   63.000   26.000   28.210 0.763 10 15 Dyn
  10 N  -86.000  138.000   30.000   19.000   47.190 0.805 10 14 Dyn
  11 P  -57.000  -32.000   10.000    9.000   61.570 0.835 10 14 Good
  12 V  -62.000  -40.000    9.000   10.000   45.250 0.888 10 14 Good
  13 V  -63.000  -46.000    6.000    5.000   26.420 0.915 10 15 Good
  14 H  -60.000  -37.000    6.000    4.000   25.450 0.934 10 15 Good
  15 F  -64.000  -46.000    5.000    6.000   25.500 0.934 10 15 Good
  16 F  -64.000  -40.000    6.000   14.000   24.970 0.929 10 15 Good
  17 K  -59.000  -40.000    5.000   10.000   26.090 0.915 10 15 Good
  18 N  -69.000  -29.000    7.000    9.000   27.440 0.892 10 15 Good
  19 I  -68.000  -38.000    9.000    8.000   31.700 0.853 10 15 Good
  20 V  -95.000   -9.000   19.000   14.000   37.790 0.816 10 15 Good
  21 T -104.000  143.000   31.000   27.000   59.330 0.743 10 14 Dyn
  22 P  -67.000  150.000   12.000   11.000   66.580 0.710 10 14 Good
  23 R  -68.000  136.000   78.000   41.000   45.550 0.691 10 14 Dyn
  24 T -100.000  133.000   27.000   17.000   49.170 0.740 10 14 Dyn
  25 P  -71.000  146.000   11.000    8.000   73.590 0.728 10 13 Good
  26 P  -68.000  155.000    6.000   10.000   86.470 0.701 10 12 Good
  27 P  -70.000  152.000    8.000    9.000   67.190 0.629 10 13 Good
  28 S  -55.000  139.000   71.000   43.000   47.880 0.594 10 14 Dyn
  29 Q  -91.000  -16.000   27.000   28.000   36.920 0.570  8 14 Dyn
  30 G -152.000  154.000   91.000   28.000   34.840 0.561  8 14 Dyn
  31 K  -86.000  139.000   30.000   28.000   38.910 0.557 10 13 Dyn
  32 G    1.000  158.000   99.000   37.000   34.370 0.548  8 14 Dyn
  33 R  -90.000   -2.000   21.000   10.000   49.100 0.527  5 13 Dyn
  34 G   93.000   -2.000   13.000   21.000   67.930 0.479 10 14 Dyn
  35 L  -65.000  127.000   55.000   16.000   41.580 0.432 10 14 Dyn
  36 S 9999.000 9999.000    0.000    0.000    0.000 0.000  0 10 None

# talos2cns_phi_psi.tbl



Please acknowledge these references in publications where the data from this site have been utilized.

Contact the webmaster for help, if required. Thursday, May 23, 2024 7:40:11 PM GMT (wattos1)