BMRB

Biological Magnetic Resonance Data Bank


A Repository for Data from NMR Spectroscopy on Proteins, Peptides, Nucleic Acids, and other Biomolecules
Member of WWPDB

BMRB Entry 26889

Title: 1H, 13C assignments for bovine insulin

Authors: Efimov, Sergey; Zgadzay, Yuriy; Klochkov, Vladimir

Citation: Zgadzay, Yuriy; Efimov, Sergey; Klochkov, Vladimir. "Spectroscopic and Structural Data for Bovine Insulin obtained by NMR"  Not known ., .-..

Assembly members:
bovine_insulin, polymer, 51 residues, Formula weight is not available

Natural source:   Common Name: cow   Taxonomy ID: 9913   Superkingdom: Eukaryota   Kingdom: Metazoa   Genus/species: Bos taurus

Experimental source:   Production method: obtained from a vendor   Host organism: Bos taurus

Entity Sequences (FASTA):
bovine_insulin: GIVEQCCASVCSLYQLENYC NFVNQHLCGSHLVEALYLVC GERGFFYTPKA

Data sets:
Data typeCount
13C chemical shifts179
1H chemical shifts359

Additional metadata:

  • Assembly
  • Samples and Experiments
  • Software
  • Spectrometers
  • Hide all

Assembly:

Entity Assembly IDEntity NameEntity ID
1bovine insulin, chain A and B1

Entities:

Entity 1, bovine insulin, chain A and B 51 residues - Formula weight is not available

Chain A: GIVEQCCASVCSLYQLENYCN Chain B: FVNQHLCGSHLVEALYLVCGERGFFYTPKA

1   GLYILEVALGLUGLNCYSCYSALASERVAL
2   CYSSERLEUTYRGLNLEUGLUASNTYRCYS
3   ASNPHEVALASNGLNHISLEUCYSGLYSER
4   HISLEUVALGLUALALEUTYRLEUVALCYS
5   GLYGLUARGGLYPHEPHETYRTHRPROLYS
6   ALA

Samples:

sample_1: bovine insulin 1.1 mM

sample_conditions_1: pH: 2.86; pressure: 1 atm; temperature: 293 K

Experiments:

NameSampleSample stateSample conditions
2D 1H-1H TOCSYsample_1isotropicsample_conditions_1
2D 1H-1H NOESYsample_1isotropicsample_conditions_1
2D DQF-COSYsample_1isotropicsample_conditions_1
2D 1H-13C HSQCsample_1isotropicsample_conditions_1

Software:

NMRPipe, Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax - processing

SPARKY, Goddard - chemical shift assignment, peak picking

TOPSPIN v3.2, Bruker Biospin - collection

NMR spectrometers:

  • Bruker Avance 700 MHz

Related Database Links: