BMRB Logo

Biological Magnetic Resonance Data Bank


A Repository for Data from NMR Spectroscopy on Proteins, Peptides, Nucleic Acids, and other Biomolecules

Search Archive Validation Tools Deposit Data NMR Statistics Spectroscopists' Corner Programmers' Corner Home
Site Map FTP Access Structural Genomics
and other "omics"
Metabolomics Educational Outreach NMR Data Formats Useful NMR Links
Search Menu

search result

# /website/admin/fasta/fasta.engine -q -w 120 -p @ /website/admin/fasta/protein.lib
FASTA searches a protein or DNA sequence data bank
 version 35.04 Feb. 20, 2010
Please cite:
 W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: @
  1>>>  - 8 aa
Library: /website/admin/fasta/protein.lib  910524 residues in  9133 sequences

       opt      E()
< 20    47     0:===
  22    37     0:===        one = represents 17 library sequences
  24    25     0:==
  26    30     0:==
  28    14     2:*
  30    23    13:*=
  32    18    48:==*
  34    52   131:====   *
  36   149   269:=========      *
  38   322   445:===================       *
  40   503   621:==============================      *
  42   757   759:============================================*
  44   944   837:=================================================*======
  46   993   853:==================================================*========
  48   800   816:===============================================*
  50   805   745:===========================================*====
  52   660   655:======================================*
  54   599   559:================================*===
  56   571   467:===========================*======
  58   381   384:======================*
  60   250   311:===============   *
  62   239   249:==============*
  64   152   198:=========  *
  66   107   157:=======  *
  68   127   123:=======*
  70    74    97:=====*
  72    82    75:====*
  74    93    59:===*==
  76    70    46:==*==
  78    40    36:==*
  80    31    28:=*
  82    21    21:=*
  84    23    17:*=
  86    11    13:*
  88    11    10:*          inset = represents 2 library sequences
  90     5     8:*
  92     2     6:*         := *
  94     0     5:*         :  *
  96     1     4:*         :=*
  98     0     3:*         : *
 100     1     2:*         :*
 102     0     2:*         :*
 104     1     1:*         :*
 106     5     1:*         :*==
 108     0     1:*         :*
 110     0     1:*         :*
 112     0     0:          *
 114     2     0:=         *=
 116     0     0:          *
 118     0     0:          *
>120    51     0:===       *==========================
 910522 residues in  9129 sequences
Statistics: MLE_cen statistics: Lambda= 0.2262;  K=0.03525 (cen=456)
 Kolmogorov-Smirnov  statistic: 0.0395 (N=29) at  42
Algorithm: FASTA (3.5 Sept 2006) [optimized]
Parameters: BL50 matrix (15:-5) ktup: 1
 join: 49, opt: 37, open/ext: -10/-2, width:  16
 Scan time:  0.080

The best scores are:                                                                                                  opt bits E(9129)
Entry 20052 entity Human_Insulin_A-chain_peptide (  15)   62 25.1   0.031
Entry 20053 entity Insulin_A-chain_variant_peptideEntry 15464 entity chain A                       (  21)   62 25.1   0.044
Entry 16026 entity INSULIN_A_CHAIN               (  21)   62 25.1   0.044
Entry 18925 entity chain_A                       (  21)   62 25.1   0.044
Entry 16027 entity INSULIN_A_CHAIN               (  21)   62 25.1   0.044
Entry 998 entity insulin A chain                   (  21)   62 25.1   0.044
Entry 1344 entity insulin A chain                 (  21)   62 25.1   0.044
Entry 996 entity insulin A chain                   (  21)   62 25.1   0.044
Entry 1006 entity insulin A chain                 (  21)   62 25.1   0.044
Entry 1632 entity insulin A chain                 (  21)   62 25.1   0.044
Entry 11016 entity Chain A                       (  21)   62 25.1   0.044
Entry 17107 entity entity_1                      (  21)   62 25.1   0.044
Entry 994 entity insulin A chain                   (  21)   62 25.1   0.044
Entry 1002 entity insulin A chain                 (  21)   62 25.1   0.044
Entry 554 entity insulin A chain                   (  21)   62 25.1   0.044
Entry 18921 entity chain_A                       (  21)   62 25.1   0.044
Entry 18924 entity chain_A                       (  21)   62 25.1   0.044
Entry 18923 entity chain_A                       (  21)   62 25.1   0.044
Entry 18858 entity entity_1                      (  21)   62 25.1   0.044
Entry 1761 entity insulin A chain                 (  21)   62 25.1   0.044
Entry 1018 entity insulin A chain                 (  21)   62 25.1   0.044
Entry 16663 entity entity, chain 1               (  21)   62 25.1   0.044
Entry 1008 entity insulin A chain                 (  21)   62 25.1   0.044
Entry 1022 entity insulin A chain                 (  21)   62 25.1   0.044
Entry 16343 entity INSULIN_A_CHAIN               (  21)   62 25.1   0.044
Entry 1010 entity insulin A chain                 (  21)   62 25.1   0.044
Entry 936 entity insulin A chain                   (  21)   62 25.1   0.044
Entry 1004 entity insulin A chain                 (  21)   62 25.1   0.044
Entry 18859 entity entity_1                      (  21)   62 25.1   0.044
Entry 1014 entity insulin A chain                 (  21)   62 25.1   0.044
Entry 1000 entity insulin A chain                 (  21)   62 25.1   0.044
Entry 1012 entity insulin A chain                 (  21)   62 25.1   0.044
Entry 1020 entity insulin A chain                 (  21)   62 25.1   0.044
Entry 1016 entity insulin A chain                 (  21)   62 25.1   0.044
Entry 556 entity insulin A chain                   (  21)   62 25.1   0.044
Entry 17803 entity InsulinGR 1                   (  22)   62 25.1   0.046
Entry 16915 entity entity, chain 1               (  22)   62 25.1   0.046
Entry 1024 entity insulin_A_chain                 (  22)   62 25.1   0.046
Entry 4266 entity D-AlaB26_DTI-amide              (  47)   62 25.1   0.098
Entry 1442 entity insulin A chain                 (  21)   57 23.4    0.14
Entry 15450 entity A-chain                       (  21)   57 23.4    0.14
Entry 1443 entity insulin A chain                 (  21)   57 23.4    0.14
Entry 15454 entity allo-Thr_A_chain              (  21)   56 23.1    0.17
Entry 15455 entity A_chain                       (  21)   56 23.1    0.17
Entry 16608 entity Proinsulin                    (  86)   62 25.1    0.18
Entry 1585 entity insulin A chain                 (  21)   54 22.5    0.27
Entry 1587 entity insulin A chain                 (  21)   54 22.5    0.27
Entry 18654 entity Single-chain Insulin          (  57)   57 23.4    0.37
Entry 1023 entity insulin B chain                 (  42)   54 22.5    0.54
Entry 17108 entity entity_1                      (  21)   50 21.1    0.66
Entry 4832 entity IGF-1                           (  57)   52 21.8     1.1
Entry 17127 entity IGF2                          (  67)   52 21.8     1.3
Entry 2498 entity insulin-like growth factor-I    (  70)   48 20.5     3.5
Entry 15654 entity Insulin-like_growth_factor-I_(IGF (  70)   48 20.5     3.5
Entry 4204 entity IGF-I                           (  70)   48 20.5     3.5
Entry 4278 entity Long-L60-IGF-I                  (  83)   48 20.5     4.1
Entry 4069 entity Long-(Arg-3)-IGF-I              (  83)   48 20.5     4.1
Entry 4494 entity IGF-I                           (  83)   48 20.5     4.1
Entry 2275 entity cobratoxin                      (  62)   44 19.2     7.6

>>Entry 20052 entity Human_Insulin_A-chain_peptide      (15 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 143.6  bits: 25.1 E(): 0.031
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                      
       GIVEQCCT       
       ::::::::       
<A     GIVEQCCTSICSLYQ
               10     

>>Entry 20053 entity Insulin_A-chain_variant_peptide    (17 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 142.6  bits: 25.1 E(): 0.035
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:3-10)

                        
         GIVEQCCT       
         ::::::::       
<A     KRGIVEQCCTSICSLYQ
               10       

>>Entry 15464 entity chain A                            (21 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 141.0  bits: 25.1 E(): 0.044
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                            
       GIVEQCCT             
       ::::::::             
<A     GIVEQCCTSICSLYQLENYCN
               10        20 

>>Entry 16026 entity INSULIN_A_CHAIN                    (21 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 141.0  bits: 25.1 E(): 0.044
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                            
       GIVEQCCT             
       ::::::::             
<A     GIVEQCCTSICSLYQLENYCN
               10        20 

>>Entry 18925 entity chain_A                            (21 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 141.0  bits: 25.1 E(): 0.044
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                            
       GIVEQCCT             
       ::::::::             
<A     GIVEQCCTSICSLYQLENYCN
               10        20 

>>Entry 16027 entity INSULIN_A_CHAIN                    (21 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 141.0  bits: 25.1 E(): 0.044
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                            
       GIVEQCCT             
       ::::::::             
<A     GIVEQCCTSICSLYQLENYCN
               10        20 

>>Entry 998 entity insulin A chain                        (21 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 141.0  bits: 25.1 E(): 0.044
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                            
       GIVEQCCT             
       ::::::::             
<A     GIVEQCCTSICSLYQLENYCN
               10        20 

>>Entry 1344 entity insulin A chain                      (21 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 141.0  bits: 25.1 E(): 0.044
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                            
       GIVEQCCT             
       ::::::::             
<A     GIVEQCCTSICSLYQLENYCN
               10        20 

>>Entry 996 entity insulin A chain                        (21 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 141.0  bits: 25.1 E(): 0.044
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                            
       GIVEQCCT             
       ::::::::             
<A     GIVEQCCTSICSLYQLENYCN
               10        20 

>>Entry 1006 entity insulin A chain                      (21 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 141.0  bits: 25.1 E(): 0.044
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                            
       GIVEQCCT             
       ::::::::             
<A     GIVEQCCTSICSLYQLENYCN
               10        20 

>>Entry 1632 entity insulin A chain                      (21 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 141.0  bits: 25.1 E(): 0.044
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                            
       GIVEQCCT             
       ::::::::             
<A     GIVEQCCTSICSLYQLENYCN
               10        20 

>>Entry 11016 entity Chain A                            (21 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 141.0  bits: 25.1 E(): 0.044
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                            
       GIVEQCCT             
       ::::::::             
<A     GIVEQCCTSICSLYQLENYCN
               10        20 

>>Entry 17107 entity entity_1                           (21 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 141.0  bits: 25.1 E(): 0.044
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                            
       GIVEQCCT             
       ::::::::             
<A     GIVEQCCTSICSLYQLENYCN
               10        20 

>>Entry 994 entity insulin A chain                        (21 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 141.0  bits: 25.1 E(): 0.044
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                            
       GIVEQCCT             
       ::::::::             
<A     GIVEQCCTSICSLYQLENYCN
               10        20 

>>Entry 1002 entity insulin A chain                      (21 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 141.0  bits: 25.1 E(): 0.044
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                            
       GIVEQCCT             
       ::::::::             
<A     GIVEQCCTSICSLYQLENYCN
               10        20 

>>Entry 554 entity insulin A chain                        (21 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 141.0  bits: 25.1 E(): 0.044
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                            
       GIVEQCCT             
       ::::::::             
<A     GIVEQCCTSICSLYQLENYCN
               10        20 

>>Entry 18921 entity chain_A                            (21 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 141.0  bits: 25.1 E(): 0.044
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                            
       GIVEQCCT             
       ::::::::             
<A     GIVEQCCTSICSLYQLENYCN
               10        20 

>>Entry 18924 entity chain_A                            (21 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 141.0  bits: 25.1 E(): 0.044
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                            
       GIVEQCCT             
       ::::::::             
<A     GIVEQCCTSICSLYQLENYCN
               10        20 

>>Entry 18923 entity chain_A                            (21 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 141.0  bits: 25.1 E(): 0.044
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                            
       GIVEQCCT             
       ::::::::             
<A     GIVEQCCTSICSLYQLENYCN
               10        20 

>>Entry 18858 entity entity_1                           (21 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 141.0  bits: 25.1 E(): 0.044
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                            
       GIVEQCCT             
       ::::::::             
<A     GIVEQCCTSICSLYQLENYCN
               10        20 

>>Entry 1761 entity insulin A chain                      (21 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 141.0  bits: 25.1 E(): 0.044
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                            
       GIVEQCCT             
       ::::::::             
<A     GIVEQCCTSICSLYQLENYCN
               10        20 

>>Entry 1018 entity insulin A chain                      (21 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 141.0  bits: 25.1 E(): 0.044
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                            
       GIVEQCCT             
       ::::::::             
<A     GIVEQCCTSICSLYQLENYCN
               10        20 

>>Entry 16663 entity entity, chain 1                    (21 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 141.0  bits: 25.1 E(): 0.044
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                            
       GIVEQCCT             
       ::::::::             
<A     GIVEQCCTSICSLYQLENYCN
               10        20 

>>Entry 1008 entity insulin A chain                      (21 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 141.0  bits: 25.1 E(): 0.044
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                            
       GIVEQCCT             
       ::::::::             
<A     GIVEQCCTSICSLYQLENYCN
               10        20 

>>Entry 1022 entity insulin A chain                      (21 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 141.0  bits: 25.1 E(): 0.044
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                            
       GIVEQCCT             
       ::::::::             
<A     GIVEQCCTSICSLYQLENYCN
               10        20 

>>Entry 16343 entity INSULIN_A_CHAIN                    (21 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 141.0  bits: 25.1 E(): 0.044
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                            
       GIVEQCCT             
       ::::::::             
<A     GIVEQCCTSICSLYQLENYCN
               10        20 

>>Entry 1010 entity insulin A chain                      (21 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 141.0  bits: 25.1 E(): 0.044
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                            
       GIVEQCCT             
       ::::::::             
<A     GIVEQCCTSICSLYQLENYCN
               10        20 

>>Entry 936 entity insulin A chain                        (21 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 141.0  bits: 25.1 E(): 0.044
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                            
       GIVEQCCT             
       ::::::::             
<A     GIVEQCCTSICSLYQLENYCN
               10        20 

>>Entry 1004 entity insulin A chain                      (21 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 141.0  bits: 25.1 E(): 0.044
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                            
       GIVEQCCT             
       ::::::::             
<A     GIVEQCCTSICSLYQLENYCN
               10        20 

>>Entry 18859 entity entity_1                           (21 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 141.0  bits: 25.1 E(): 0.044
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                            
       GIVEQCCT             
       ::::::::             
<A     GIVEQCCTSICSLYQLENYCN
               10        20 

>>Entry 1014 entity insulin A chain                      (21 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 141.0  bits: 25.1 E(): 0.044
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                            
       GIVEQCCT             
       ::::::::             
<A     GIVEQCCTSICSLYQLENYCN
               10        20 

>>Entry 1000 entity insulin A chain                      (21 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 141.0  bits: 25.1 E(): 0.044
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                            
       GIVEQCCT             
       ::::::::             
<A     GIVEQCCTSICSLYQLENYCN
               10        20 

>>Entry 1012 entity insulin A chain                      (21 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 141.0  bits: 25.1 E(): 0.044
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                            
       GIVEQCCT             
       ::::::::             
<A     GIVEQCCTSICSLYQLENYCN
               10        20 

>>Entry 1020 entity insulin A chain                      (21 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 141.0  bits: 25.1 E(): 0.044
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                            
       GIVEQCCT             
       ::::::::             
<A     GIVEQCCTSICSLYQLENYCN
               10        20 

>>Entry 1016 entity insulin A chain                      (21 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 141.0  bits: 25.1 E(): 0.044
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                            
       GIVEQCCT             
       ::::::::             
<A     GIVEQCCTSICSLYQLENYCN
               10        20 

>>Entry 556 entity insulin A chain                        (21 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 141.0  bits: 25.1 E(): 0.044
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                            
       GIVEQCCT             
       ::::::::             
<A     GIVEQCCTSICSLYQLENYCN
               10        20 

>>Entry 17803 entity InsulinGR 1                        (22 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 140.6  bits: 25.1 E(): 0.046
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                             
       GIVEQCCT              
       ::::::::              
<A     GIVEQCCTSICSLYQLENYCNG
               10        20  

>>Entry 16915 entity entity, chain 1                    (22 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 140.6  bits: 25.1 E(): 0.046
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                             
       GIVEQCCT              
       ::::::::              
<A     GIVEQCCTSICSLYQLENYCNG
               10        20  

>>Entry 1024 entity insulin_A_chain                      (22 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 140.6  bits: 25.1 E(): 0.046
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                             
       GIVEQCCT              
       ::::::::              
<A     GIVEQCCTSICSLXQLENYCNG
               10        20  

>>Entry 4266 entity D-AlaB26_DTI-amide                   (47 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 134.7  bits: 25.1 E(): 0.098
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                                                      
       GIVEQCCT                                       
       ::::::::                                       
<A     GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFA
               10        20        30        40       

>>Entry 1442 entity insulin A chain                      (21 aa)
 initn:  57 init1:  57 opt:  57  Z-score: 132.2  bits: 23.4 E(): 0.14
Smith-Waterman score: 57; 100.0% identity (100.0% similar) in 7 aa overlap (1-7:1-7)

                            
       GIVEQCCT             
       :::::::              
<A     GIVEQCCASVCSLYQLENYCN
               10        20 

>>Entry 15450 entity A-chain                            (21 aa)
 initn:  57 init1:  57 opt:  57  Z-score: 132.2  bits: 23.4 E(): 0.14
Smith-Waterman score: 57; 87.5% identity (100.0% similar) in 8 aa overlap (1-8:1-8)

                            
       GIVEQCCT             
       ::.:::::             
<A     GITEQCCTSICSLYQLENYCN
               10        20 

>>Entry 1443 entity insulin A chain                      (21 aa)
 initn:  57 init1:  57 opt:  57  Z-score: 132.2  bits: 23.4 E(): 0.14
Smith-Waterman score: 57; 100.0% identity (100.0% similar) in 7 aa overlap (1-7:1-7)

                            
       GIVEQCCT             
       :::::::              
<A     GIVEQCCASVCSLYQLENYCN
               10        20 

>>Entry 15454 entity allo-Thr_A_chain                   (21 aa)
 initn:  56 init1:  56 opt:  56  Z-score: 130.4  bits: 23.1 E(): 0.17
Smith-Waterman score: 56; 87.5% identity (87.5% similar) in 8 aa overlap (1-8:1-8)

                            
       GIVEQCCT             
       :: :::::             
<A     GIXEQCCTSICSLYQLENYCN
               10        20 

>>Entry 15455 entity A_chain                            (21 aa)
 initn:  56 init1:  56 opt:  56  Z-score: 130.4  bits: 23.1 E(): 0.17
Smith-Waterman score: 56; 87.5% identity (87.5% similar) in 8 aa overlap (1-8:1-8)

                            
       GIVEQCCT             
       :: :::::             
<A     GIXEQCCTSICSLYQLENYCN
               10        20 

>>Entry 16608 entity Proinsulin                         (86 aa)
 initn:  62 init1:  62 opt:  62  Z-score: 130.0  bits: 25.1 E(): 0.18
Smith-Waterman score: 62; 100.0% identity (100.0% similar) in 8 aa overlap (1-8:66-73)

                                                                                        
                                                                   GIVEQCCT             
                                                                   ::::::::             
<A     LCGSDLVEALYLVCGERGFFYTKPTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN
          10        20        30        40        50        60        70        80      

>>Entry 1585 entity insulin A chain                      (21 aa)
 initn:  54 init1:  54 opt:  54  Z-score: 126.9  bits: 22.5 E(): 0.27
Smith-Waterman score: 54; 100.0% identity (100.0% similar) in 7 aa overlap (2-8:2-8)

                            
       GIVEQCCT             
        :::::::             
<A     XIVEQCCTSICSLYQLENYCN
               10        20 

>>Entry 1587 entity insulin A chain                      (21 aa)
 initn:  54 init1:  54 opt:  54  Z-score: 126.9  bits: 22.5 E(): 0.27
Smith-Waterman score: 54; 100.0% identity (100.0% similar) in 7 aa overlap (2-8:2-8)

                            
       GIVEQCCT             
        :::::::             
<A     XIVEQCCTSICSLYQLENYCN
               10        20 

>>Entry 18654 entity Single-chain Insulin               (57 aa)
 initn:  57 init1:  57 opt:  57  Z-score: 124.4  bits: 23.4 E(): 0.37
Smith-Waterman score: 57; 100.0% identity (100.0% similar) in 7 aa overlap (1-7:37-43)

                                                                
                                           GIVEQCCT             
                                           :::::::              
<A     FVNQHLCGSDLVEALYLVCGERGFFYTDPTGGGPRRGIVEQCCHSICSLYQLENYCN
               10        20        30        40        50       

>>Entry 1023 entity insulin B chain                      (42 aa)
 initn:  54 init1:  54 opt:  54  Z-score: 121.5  bits: 22.5 E(): 0.54
Smith-Waterman score: 54; 100.0% identity (100.0% similar) in 7 aa overlap (2-8:23-29)

                                                 
                            GIVEQCCT             
                             :::::::             
<A     FVNQHLCGSHLVEALYLVCGERIVEQCCTSICSLYQLENYCN
               10        20        30        40  

>>Entry 17108 entity entity_1                           (21 aa)
 initn:  50 init1:  50 opt:  50  Z-score: 119.8  bits: 21.1 E(): 0.66
Smith-Waterman score: 50; 71.4% identity (100.0% similar) in 7 aa overlap (1-7:1-7)

                            
       GIVEQCCT             
       :..::::              
<A     GLLEQCCHSICSLYQLENYCN
               10        20 

>>Entry 4832 entity IGF-1                                (57 aa)
 initn:  52 init1:  52 opt:  52  Z-score: 115.6  bits: 21.8 E():  1.1
Smith-Waterman score: 52; 85.7% identity (100.0% similar) in 7 aa overlap (1-7:29-35)

                                                                
                                   GIVEQCCT                     
                                   ::::.::                      
<A     GPETLCGAELVEALQFVCGERGFYFNKPGIVEECCFRSCELRRLEMYCAPLKPAKSA
               10        20        30        40        50       

>>Entry 17127 entity IGF2                               (67 aa)
 initn:  52 init1:  52 opt:  52  Z-score: 114.3  bits: 21.8 E():  1.3
Smith-Waterman score: 52; 85.7% identity (100.0% similar) in 7 aa overlap (1-7:41-47)

                                                                          
                                               GIVEQCCT                   
                                               ::::.::                    
<A     AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
               10        20        30        40        50        60       

>>Entry 2498 entity insulin-like growth factor-I         (70 aa)
 initn:  48 init1:  48 opt:  48  Z-score: 106.9  bits: 20.5 E():  3.5
Smith-Waterman score: 48; 71.4% identity (100.0% similar) in 7 aa overlap (1-7:42-48)

                                                                             
                                                GIVEQCCT                     
                                                :::..::                      
<A     GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
               10        20        30        40        50        60        70

>>Entry 15654 entity Insulin-like_growth_factor-I_(IGF-I)<  (70 aa)
 initn:  48 init1:  48 opt:  48  Z-score: 106.9  bits: 20.5 E():  3.5
Smith-Waterman score: 48; 71.4% identity (100.0% similar) in 7 aa overlap (1-7:42-48)

                                                                             
                                                GIVEQCCT                     
                                                :::..::                      
<A     GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
               10        20        30        40        50        60        70

>>Entry 4204 entity IGF-I                                (70 aa)
 initn:  48 init1:  48 opt:  48  Z-score: 106.9  bits: 20.5 E():  3.5
Smith-Waterman score: 48; 71.4% identity (100.0% similar) in 7 aa overlap (1-7:42-48)

                                                                             
                                                GIVEQCCT                     
                                                :::..::                      
<A     GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
               10        20        30        40        50        60        70

>>Entry 4278 entity Long-L60-IGF-I                       (83 aa)
 initn:  48 init1:  48 opt:  48  Z-score: 105.6  bits: 20.5 E():  4.1
Smith-Waterman score: 48; 71.4% identity (100.0% similar) in 7 aa overlap (1-7:55-61)

                                                                                          
                                                             GIVEQCCT                     
                                                             :::..::                      
<A     MFPAMPLSSLFVNGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMLCAPLKPAKSA
               10        20        30        40        50        60        70        80   

>>Entry 4069 entity Long-(Arg-3)-IGF-I                   (83 aa)
 initn:  48 init1:  48 opt:  48  Z-score: 105.6  bits: 20.5 E():  4.1
Smith-Waterman score: 48; 71.4% identity (100.0% similar) in 7 aa overlap (1-7:55-61)

                                                                                          
                                                             GIVEQCCT                     
                                                             :::..::                      
<A     MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
               10        20        30        40        50        60        70        80   

>>Entry 4494 entity IGF-I                                (83 aa)
 initn:  48 init1:  48 opt:  48  Z-score: 105.6  bits: 20.5 E():  4.1
Smith-Waterman score: 48; 71.4% identity (100.0% similar) in 7 aa overlap (1-7:55-61)

                                                                                          
                                                             GIVEQCCT                     
                                                             :::..::                      
<A     MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
               10        20        30        40        50        60        70        80   

>>Entry 2275 entity cobratoxin                           (62 aa)
 initn:  44 init1:  44 opt:  44  Z-score: 100.8  bits: 19.2 E():  7.6
Smith-Waterman score: 44; 62.5% identity (87.5% similar) in 8 aa overlap (1-8:49-56)

                                                                     
                                                       GIVEQCCT      
                                                       ::. .:::      
<A     LECHNQQSSQTPTTTGCSGGETNCYKKRWRDHRGYRTERGCGCPSVKNGIIINCCTTDRCNN
               10        20        30        40        50        60  



8 residues in 1 query   sequences
910524 residues in 9133 library sequences
 Tcomplib [35.04] (8 proc)
 start: Sun Sep 15 10:05:50 2013 done: Sun Sep 15 10:05:50 2013
 Total Scan time:  0.080 Total Display time:  0.000

Function used was FASTA [version 35.04 Feb. 20, 2010]
 
Contact bmrbhelp@bmrb.wisc.edu if you have any questions about this site

Copyright © The Board of Regents of the University of Wisconsin System.
Last Modified: