BMRB

Biological Magnetic Resonance Data Bank


A Repository for Data from NMR Spectroscopy on Proteins, Peptides, Nucleic Acids, and other Biomolecules
Member of WWPDB
# /website/admin/fasta/fasta.engine -q -w 120 -p @ /website/ftp/pub/bmrb/sequence_libraries/protein.lib
FASTA searches a protein or DNA sequence data bank
 version 35.04 Feb. 20, 2010
Please cite:
 W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: @
  1>>>  - 97 aa
Library: /website/ftp/pub/bmrb/sequence_libraries/protein.lib 1278045 residues in 12628 sequences

       opt      E()
< 20   469     0:================
  22     0     0:           one = represents 30 library sequences
  24     0     0:
  26     0     0:
  28     6     3:*
  30    10    17:*
  32    11    67:= *
  34    19   181:=     *
  36    49   371:==          *
  38   188   613:=======             *
  40   551   856:===================         *
  42  1023  1046:==================================*
  44  1464  1154:======================================*==========
  46  1753  1175:=======================================*===================
  48  1590  1125:=====================================*===============
  50  1244  1027:==================================*=======
  52  1086   903:==============================*======
  54   729   771:=========================*
  56   535   644:==================   *
  58   382   529:=============    *
  60   269   428:=========     *
  62   198   343:=======    *
  64   160   273:======   *
  66   139   216:=====  *
  68   112   170:==== *
  70    84   133:=== *
  72    81   104:===*
  74   110    81:==*=
  76    63    63:==*
  78    88    49:=*=
  80    34    38:=*
  82    12    29:*
  84    14    23:*
  86     3    18:*
  88     1    14:*          inset = represents 3 library sequences
  90     4    11:*
  92     3     8:*         := *
  94     2     6:*         :=*
  96     1     5:*         :=*
  98     4     4:*         :=*
 100     4     3:*         :*=
 102     2     2:*         :*
 104     1     2:*         :*
 106     0     1:*         :*
 108     0     1:*         :*
 110     2     1:*         :*
 112     3     1:*         :*
 114     2     0:=         *=
 116     1     0:=         *=
 118     2     0:=         *=
>120   118     0:====      *========================================
1278043 residues in 12626 sequences
Statistics:  Expectation_n fit: rho(ln(x))= 5.2817+/-0.000523; mu= 2.7491+/- 0.023
 mean_var=72.7456+/-17.873, 0's: 240 Z-trim: 561  B-trim: 0 in 0/44
 Lambda= 0.150373
 Kolmogorov-Smirnov  statistic: 0.1067 (N=29) at  42
Algorithm: FASTA (3.5 Sept 2006) [optimized]
Parameters: BL50 matrix (15:-5) ktup: 2
 join: 42, opt: 30, open/ext: -10/-2, width:  16
 Scan time:  0.110

The best scores are:                                                                                                  opt bits E(12626)
entry 18845, entity SUP-12                                                                                     (  97)  646 148.3 2.6e-37
entry 18846, entity SUP-12                                                                                     (  97)  646 148.3 2.6e-37
entry 19653, entity PROTEIN_SUP-12_ISOFORM_B                                                                   (  97)  646 148.3 2.6e-37
entry 11541, entity entity_1                                                                                   ( 103)  627 144.2 4.8e-36
entry 19609, entity entity_2                                                                                   ( 105)  627 144.2 4.9e-36
entry 25885, entity RBM24                                                                                      ( 105)  506 118.0 3.9e-28
entry 27111, entity MSI2_RRM1                                                                                  ( 115)  222 56.4 1.5e-09
entry 19525, entity RNA-BINDING_GLYCINE-RICH_PROTEIN                                                           (  86)  216 55.0 2.9e-09
entry 11450, entity entity_1                                                                                   ( 109)  205 52.7 1.8e-08
entry 4084, entity human hnRNP A1                                                                              (  93)  193 50.1 9.8e-08
entry 34079, entity entity_1                                                                                   (  97)  193 50.1   1e-07
entry 18728, entity UP1                                                                                        ( 197)  193 50.3 1.8e-07
entry 36058, entity entity_1                                                                                   (  96)  189 49.2 1.8e-07
entry 36059, entity entity_1                                                                                   (  96)  189 49.2 1.8e-07
entry 19792, entity entity                                                                                     (  92)  187 48.7 2.4e-07
entry 19382, entity hnRNP_G_RRM                                                                                (  95)  187 48.8 2.4e-07
entry 34080, entity Heterogeneous nuclear ribonucleoprotein A1                                                 ( 102)  185 48.3 3.5e-07
entry 18776, entity RBP1                                                                                       (  92)  184 48.1 3.7e-07
entry 16425, entity hrp1p                                                                                      ( 167)  181 47.6 9.4e-07
entry 17706, entity SRSF2_RRM                                                                                  ( 135)  179 47.1 1.1e-06
entry 17705, entity SRSF2_RRM                                                                                  ( 135)  179 47.1 1.1e-06
entry 17707, entity SRSF2_RRM                                                                                  ( 135)  179 47.1 1.1e-06
entry 16444, entity SC35                                                                                       ( 158)  179 47.2 1.2e-06
entry 25831, entity Rbfox_RRM                                                                                  ( 104)  160 42.9 1.5e-05
entry 6895, entity Ataxin-2-binding protein 1                                                                  ( 109)  160 42.9 1.6e-05
entry 15343, entity HR4730A                                                                                    ( 108)  156 42.1 2.9e-05
entry 6315, entity TcUBP1                                                                                      ( 139)  157 42.4   3e-05
entry 16989, entity CYP33                                                                                      (  83)  153 41.3 3.7e-05
entry 5774, entity Cleavage stimulation Factor 64, RRM domain                                                  ( 111)  153 41.4 4.6e-05
entry 25449, entity RRM                                                                                        (  89)  149 40.5   7e-05
entry 19609, entity entity_1                                                                                   (  94)  148 40.3 8.5e-05
entry 19680, entity ASD-1                                                                                      (  99)  148 40.3 8.9e-05
entry 19686, entity ASD-1                                                                                      (  99)  148 40.3 8.9e-05
entry 18765, entity RRM1                                                                                       ( 103)  147 40.1 0.00011
entry 19064, entity TIAR_RRM2                                                                                  ( 101)  146 39.9 0.00012
entry 19063, entity TIAR_RRM2                                                                                  ( 101)  146 39.9 0.00012
entry 4711, entity RNA-binding protein                                                                         ( 101)  144 39.4 0.00017
entry 11374, entity RRM domain                                                                                 ( 115)  144 39.5 0.00018
entry 11376, entity RRM domain                                                                                 ( 115)  144 39.5 0.00018
entry 11375, entity RRM domain                                                                                 ( 115)  144 39.5 0.00018
entry 11370, entity RRM domain C terminal truncated                                                            (  87)  142 39.0  0.0002
entry 19290, entity TAR_DNA-BINDING_PROTEIN_43                                                                 ( 174)  143 39.4  0.0003
entry 19735, entity TIA-1_RRM2,3                                                                               ( 185)  142 39.2 0.00036
entry 6121, entity CUG-BP                                                                                      ( 187)  142 39.2 0.00036
entry 11372, entity RRM domain K138A mutant                                                                    ( 103)  137 37.9 0.00048
entry 11373, entity RRM domain T134A mutant                                                                    ( 103)  137 37.9 0.00048
entry 5764, entity ALY                                                                                         ( 106)  137 37.9 0.00049
entry 15942, entity PABP1                                                                                      (  95)  134 37.3 0.00071
entry 17622, entity HUMAN_U2AF65                                                                               ( 198)  136 37.9 0.00094
entry 17623, entity HUMAN_U2AF65                                                                               ( 198)  136 37.9 0.00094
entry 11371, entity RRM domain D131A mutant                                                                    ( 103)  132 36.8   0.001
entry 11408, entity RNA RECOGNITION MOTIF, RESIDUES 383-484                                                    ( 115)  132 36.9  0.0011
entry 11407, entity RNA recognition motif                                                                      ( 115)  132 36.9  0.0011
entry 11406, entity RNA recognition motif                                                                      ( 115)  132 36.9  0.0011
entry 11405, entity RNA recognition motif                                                                      ( 115)  132 36.9  0.0011
entry 16708, entity BRUNOL-3                                                                                   ( 199)  132 37.0  0.0017
entry 16683, entity REF_54-155                                                                                 ( 124)  129 36.3  0.0019
entry 17693, entity RNA_AND_EXPORT_FACTOR-BINDING_PROTEIN_2                                                    ( 124)  129 36.3  0.0019
entry 7435, entity REF_54-155                                                                                  ( 124)  129 36.3  0.0019
entry 16697, entity REF_54-155                                                                                 ( 124)  129 36.3  0.0019
entry 7023, entity REF2-I residues 1-155                                                                       ( 177)  129 36.4  0.0025
entry 25072, entity Sex-lethal_(SXL)                                                                           ( 176)  128 36.1  0.0028
entry 4028, entity Sex-lethal protein                                                                          ( 184)  128 36.2  0.0029
entry 4029, entity Sex-lethal protein                                                                          ( 184)  128 36.2  0.0029
entry 36018, entity Splicing factor 3B subunit 4                                                               ( 105)  125 35.3   0.003
entry 27155, entity entity_1                                                                                   ( 114)  125 35.4  0.0032
entry 27142, entity entity_1                                                                                   ( 114)  125 35.4  0.0032
entry 26628, entity HuR                                                                                        ( 193)  127 36.0  0.0036
entry 27156, entity entity_1                                                                                   ( 114)  124 35.1  0.0037
entry 27152, entity entity_1                                                                                   ( 114)  124 35.1  0.0037
entry 27002, entity HuR_RRM1-RRM2                                                                              ( 210)  127 36.0  0.0038
entry 19499, entity HUR_RRM3_W261E_mutant                                                                      ( 124)  124 35.2  0.0039
entry 16884, entity RRM3                                                                                       (  97)  122 34.7  0.0044
entry 19685, entity entity                                                                                     (  97)  122 34.7  0.0044
entry 11458, entity entity                                                                                     (  99)  122 34.7  0.0044
entry 25244, entity HuR_RRM1                                                                                   ( 101)  122 34.7  0.0045
entry 30155, entity entity_1                                                                                   ( 101)  122 34.7  0.0045
entry 34057, entity CUGBP Elav-like family member 2                                                            ( 114)  122 34.7   0.005
entry 27140, entity CUG_BP2_RRM3                                                                               ( 114)  122 34.7   0.005
entry 27154, entity entity_1                                                                                   ( 114)  122 34.7   0.005
entry 19766, entity Snu17p                                                                                     ( 118)  122 34.7  0.0051
entry 25443, entity Snu17p                                                                                     ( 118)  122 34.7  0.0051
entry 25442, entity Snu17p                                                                                     ( 118)  122 34.7  0.0051
entry 27157, entity entity_1                                                                                   ( 114)  121 34.5  0.0058
entry 27153, entity entity_1                                                                                   ( 114)  121 34.5  0.0058
entry 25497, entity RRM1                                                                                       (  95)  120 34.2  0.0058
entry 16236, entity Bruno_RRM3+                                                                                ( 118)  121 34.5  0.0059
entry 19500, entity HUR_RRM3_S318D_mutant                                                                      ( 124)  121 34.5  0.0062
entry 19494, entity HUR_RRM3_polypeptide                                                                       ( 124)  121 34.5  0.0062
entry 4085, entity Sex-lethal protein RNA binding domain 2                                                     (  97)  119 34.0  0.0069
entry 15528, entity ePABP2-trp                                                                                 ( 124)  119 34.1  0.0083
entry 25047, entity RRM                                                                                        (  93)  114 32.9   0.014
entry 19922, entity TDP-43_RRM2                                                                                (  76)  109 31.8   0.025
entry 25800, entity PfSR1-RRM1                                                                                 (  89)  109 31.8   0.029
entry 25650, entity PfSR1-RRM1                                                                                 (  89)  109 31.8   0.029
entry 16425, entity rna15p                                                                                     (  84)  107 31.4   0.037
entry 26948, entity SART3_RRM2                                                                                 (  78)  104 30.7   0.055
entry 16646, entity RBD1,2                                                                                     ( 180)  107 31.6   0.068
entry 11366, entity spliceosomal protein p14, RNA recognition motif                                            (  87)  103 30.5    0.07
entry 19642, entity entity                                                                                     ( 152)  105 31.1   0.081
entry 11523, entity Nrd1_RRM2                                                                                  (  97)   99 29.7    0.14
entry 4863, entity NUCLEOLIN RBD2                                                                              (  96)   97 29.2    0.19
entry 26912, entity Nrd1                                                                                       ( 177)   99 29.9    0.22
entry 19252, entity RBM7                                                                                       ( 101)   95 28.8    0.26
entry 10077, entity RNA recognition motif                                                                      ( 104)   94 28.6    0.31
entry 11563, entity The_first_RNA_recognition_motif_domain                                                     ( 114)   94 28.6    0.33
entry 26922, entity MEC-8_RRM1                                                                                 ( 100)   93 28.4    0.35
entry 17589, entity RRM3                                                                                       (  93)   90 27.7    0.52
entry 19777, entity CPEB4RRM12                                                                                 ( 203)   94 28.8    0.53
entry 19776, entity CPEB4RRM12                                                                                 ( 203)   94 28.8    0.53
entry 19320, entity Taf15                                                                                      (  97)   88 27.3    0.73
entry 17508, entity HR6430A                                                                                    (  99)   88 27.3    0.74
entry 6930, entity snRNP protein                                                                               ( 104)   88 27.3    0.77
entry 17635, entity FUS/TLS RRM domain                                                                         ( 108)   88 27.3    0.79
entry 7383, entity Nucleolar_protein_3                                                                         (  74)   86 26.8    0.79
entry 18829, entity RRM_domain                                                                                 ( 103)   87 27.1    0.89
entry 16244, entity Prp24-RRM23                                                                                ( 186)   90 27.9     0.9
entry 16243, entity Prp24-RRM23                                                                                ( 186)   90 27.9     0.9
entry 15485, entity Npl3_RRM1                                                                                  ( 108)   86 26.9     1.1
entry 19561, entity Taf-RRM-RanBP                                                                              ( 162)   88 27.4     1.1
entry 19298, entity entity                                                                                     (  93)   83 26.2     1.5
entry 27055, entity RBM_10RRM2                                                                                 (  89)   82 26.0     1.7
entry 4772, entity RNA-binding protein with multiple splicing                                                  ( 111)   83 26.2     1.7
entry 18905, entity entity                                                                                     ( 131)   82 26.1     2.3
entry 18678, entity entity                                                                                     (  91)   80 25.5     2.3
entry 18017, entity entity                                                                                     (  95)   80 25.5     2.4
entry 34140, entity entity_1                                                                                   ( 179)   82 26.2     2.9
entry 19232, entity entity                                                                                     ( 185)   82 26.2       3
entry 19013, entity RRM_domain_of_the_hypothetical_protein                                                     ( 124)   76 24.8     5.4
entry 19778, entity CPEB1RRM12                                                                                 ( 213)   75 24.7     9.6
entry 19775, entity CPEB1RRM12                                                                                 ( 217)   75 24.7     9.7
entry 11601, entity hESRP1-RRM3                                                                                ( 104)   71 23.6     9.9

entry 18845, entity SUP-12                                                                                          (97 aa)
 initn: 646 init1: 646 opt: 646  Z-score: 775.9  bits: 148.3 E(): 2.6e-37
Smith-Waterman score: 646; 100.0% identity (100.0% similar) in 97 aa overlap (1-97:1-97)

               10        20        30        40        50        60        70        80        90       
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ
       :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
gnl|md GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ
               10        20        30        40        50        60        70        80        90       

entry 18846, entity SUP-12                                                                                          (97 aa)
 initn: 646 init1: 646 opt: 646  Z-score: 775.9  bits: 148.3 E(): 2.6e-37
Smith-Waterman score: 646; 100.0% identity (100.0% similar) in 97 aa overlap (1-97:1-97)

               10        20        30        40        50        60        70        80        90       
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ
       :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
gnl|md GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ
               10        20        30        40        50        60        70        80        90       

entry 19653, entity PROTEIN_SUP-12_ISOFORM_B                                                                        (97 aa)
 initn: 646 init1: 646 opt: 646  Z-score: 775.9  bits: 148.3 E(): 2.6e-37
Smith-Waterman score: 646; 100.0% identity (100.0% similar) in 97 aa overlap (1-97:1-97)

               10        20        30        40        50        60        70        80        90       
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ
       :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
gnl|md GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ
               10        20        30        40        50        60        70        80        90       

entry 11541, entity entity_1                                                                                        (103 aa)
 initn: 627 init1: 627 opt: 627  Z-score: 753.2  bits: 144.2 E(): 4.8e-36
Smith-Waterman score: 627; 98.9% identity (100.0% similar) in 95 aa overlap (3-97:9-103)

                     10        20        30        40        50        60        70        80        90       
             GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ
               .::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
gnl|md GSTNAEPVVGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ
               10        20        30        40        50        60        70        80        90       100   

entry 19609, entity entity_2                                                                                        (105 aa)
 initn: 627 init1: 627 opt: 627  Z-score: 753.1  bits: 144.2 E(): 4.9e-36
Smith-Waterman score: 627; 98.9% identity (100.0% similar) in 95 aa overlap (3-97:9-103)

                     10        20        30        40        50        60        70        80        90         
             GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ  
               .::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::  
gnl|md GSTNAEPVVGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQLA
               10        20        30        40        50        60        70        80        90       100     

entry 25885, entity RBM24                                                                                           (105 aa)
 initn: 502 init1: 502 opt: 506  Z-score: 611.2  bits: 118.0 E(): 3.9e-28
Smith-Waterman score: 506; 80.2% identity (91.7% similar) in 96 aa overlap (1-93:1-96)

                  10        20        30        40        50        60        70        80        90            
       GAMG---SRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ     
       :::.   ..:: .::::::::::::.: .:..::: ::.::::::::::.: :::::::::: :::.:::::::::::::::::::::::::::::         
gnl|md GAMAHTTQKDTTYTKIFVGGLPYHTTDASLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAKPRIMQPGFAFG
               10        20        30        40        50        60        70        80        90       100     

entry 27111, entity MSI2_RRM1                                                                                       (115 aa)
 initn: 183 init1: 183 opt: 222  Z-score: 277.7  bits: 56.4 E(): 1.5e-09
Smith-Waterman score: 222; 35.4% identity (74.0% similar) in 96 aa overlap (3-93:13-108)

                         10            20        30        40        50        60        70        80         90          
                 GAMGSRDTMFT----KIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAY-LGAKPRTNVQ   
                   .:... .:     :.:.::: ..::  .:..:: .::.:.: .:. : .:..:::.::::. : ::....  .:.  .:..  . ..:.   :.:.       
gnl|md MHHHHHHSTSVDLGTENLYFQSNAGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPRRAQPKMVTRTKK
               10        20        30        40        50        60        70        80        90       100       110     

entry 19525, entity RNA-BINDING_GLYCINE-RICH_PROTEIN                                                                (86 aa)
 initn: 192 init1: 192 opt: 216  Z-score: 272.4  bits: 55.0 E(): 2.9e-09
Smith-Waterman score: 216; 47.4% identity (73.7% similar) in 76 aa overlap (12-86:8-83)

               10        20        30        40        50        60        70         80        90       
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPI-IDGRKANVNLAYLGAKPRTNVQ
                  . ::::: . :.:.:: : : :::.: .. .:.::.: .:::.::::.::. . . : .  :   .:::. .:: :           
gnl|md     GMAEVEYRCFVGGLAWATTDQTLGEAFSQFGEILDSKIINDRETGRSRGFGFVTFKDEKAMRDAIEGMNGQDLDGRNITVNEAQSR        
                   10        20        30        40        50        60        70        80              

entry 11450, entity entity_1                                                                                        (109 aa)
 initn: 173 init1: 173 opt: 205  Z-score: 258.1  bits: 52.7 E(): 1.8e-08
Smith-Waterman score: 205; 35.9% identity (71.7% similar) in 92 aa overlap (3-93:21-109)

                                 10        20        30        40        50        60        70        80         90       
                         GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAY-LGAKPRTNVQ
                           :::      :.:.::: ..:... :.::: :::...: .:. :  :..:::.::::. :.:.....  .    .:..  . ..:.   :.:.    
gnl|md MGSSHHHHHHSSGLVPRGSHMGSSG---CKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQPK    
               10        20           30        40        50        60        70        80        90       100             

entry 4084, entity human hnRNP A1                                                                                   (93 aa)
 initn: 193 init1: 193 opt: 193  Z-score: 245.0  bits: 50.1 E(): 9.8e-08
Smith-Waterman score: 193; 41.2% identity (72.1% similar) in 68 aa overlap (12-79:15-82)

                  10        20        30        40        50        60        70        80        90       
          GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ
                     :.:.::: ..:.:..:. .:::.: . . ::. : ::..:::.::::.     .. : .     .:::                  
gnl|md MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSRE       
               10        20        30        40        50        60        70        80        90          

entry 34079, entity entity_1                                                                                        (97 aa)
 initn: 193 init1: 193 opt: 193  Z-score: 244.7  bits: 50.1 E(): 1e-07
Smith-Waterman score: 193; 41.2% identity (72.1% similar) in 68 aa overlap (12-79:15-82)

                  10        20        30        40        50        60        70        80        90       
          GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ
                     :.:.::: ..:.:..:. .:::.: . . ::. : ::..:::.::::.     .. : .     .:::                  
gnl|md ASKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQR   
               10        20        30        40        50        60        70        80        90          

entry 18728, entity UP1                                                                                             (197 aa)
 initn: 193 init1: 193 opt: 193  Z-score: 240.3  bits: 50.3 E(): 1.8e-07
Smith-Waterman score: 193; 41.2% identity (72.1% similar) in 68 aa overlap (12-79:16-83)

                   10        20        30        40        50        60        70        80        90                          
           GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ                   
                      :.:.::: ..:.:..:. .:::.: . . ::. : ::..:::.::::.     .. : .     .:::                                     
gnl|md GGSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEH
               10        20        30        40        50        60        70        80        90       100       110       120

gnl|md HLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGR
              130       140       150       160       170       180       190       

entry 36058, entity entity_1                                                                                        (96 aa)
 initn: 171 init1: 171 opt: 189  Z-score: 240.1  bits: 49.2 E(): 1.8e-07
Smith-Waterman score: 189; 42.4% identity (84.7% similar) in 59 aa overlap (12-70:6-64)

               10        20        30        40        50        60        70        80        90            
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ     
                  :::::::  .:. . ...:::::: ...:... :..:.. ::.::::....  .:..:.                                
gnl|md       GSHMKKIFVGGLSVNTTVEDVKHYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGSARGRS
                     10        20        30        40        50        60        70        80        90      

entry 36059, entity entity_1                                                                                        (96 aa)
 initn: 171 init1: 171 opt: 189  Z-score: 240.1  bits: 49.2 E(): 1.8e-07
Smith-Waterman score: 189; 42.4% identity (84.7% similar) in 59 aa overlap (12-70:6-64)

               10        20        30        40        50        60        70        80        90            
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ     
                  :::::::  .:. . ...:::::: ...:... :..:.. ::.::::....  .:..:.                                
gnl|md       GSHMKKIFVGGLSVNTTVEDVKHYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGSARGRS
                     10        20        30        40        50        60        70        80        90      

entry 19792, entity entity                                                                                          (92 aa)
 initn: 176 init1: 176 opt: 187  Z-score: 238.0  bits: 48.7 E(): 2.4e-07
Smith-Waterman score: 187; 40.8% identity (76.3% similar) in 76 aa overlap (12-86:11-86)

               10        20        30        40        50        60        70         80        90       
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPN-PIIDGRKANVNLAYLGAKPRTNVQ
                  :.:.:::  .:..:.:.  : ..: : :.... ::.:.::::..:::... :.:. : .: :   .::.  .:. :           
gnl|md  GHMVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQATKPSFE     
                10        20        30        40        50        60        70        80        90       

entry 19382, entity hnRNP_G_RRM                                                                                     (95 aa)
 initn: 176 init1: 176 opt: 187  Z-score: 237.8  bits: 48.8 E(): 2.4e-07
Smith-Waterman score: 187; 40.8% identity (76.3% similar) in 76 aa overlap (12-86:9-84)

               10        20        30        40        50        60        70         80        90       
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPN-PIIDGRKANVNLAYLGAKPRTNVQ
                  :.:.:::  .:..:.:.  : ..: : :.... ::.:.::::..:::... :.:. : .: :   .::.  .:. :           
gnl|md    MVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQATKPSFESGRRG
                  10        20        30        40        50        60        70        80        90     

entry 34080, entity Heterogeneous nuclear ribonucleoprotein A1                                                      (102 aa)
 initn: 177 init1: 177 opt: 185  Z-score: 235.0  bits: 48.3 E(): 3.5e-07
Smith-Waterman score: 185; 38.7% identity (70.7% similar) in 75 aa overlap (12-86:12-86)

               10        20        30        40        50        60        70        80        90            
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ     
                  ::::::.   : .. :..::::.: ::   ..:::.. :.::..:::. :. :...   .    ..:.. .:  :                
gnl|md SQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGR
               10        20        30        40        50        60        70        80        90       100  

entry 18776, entity RBP1                                                                                            (92 aa)
 initn: 158 init1: 158 opt: 184  Z-score: 234.5  bits: 48.1 E(): 3.7e-07
Smith-Waterman score: 184; 37.6% identity (68.2% similar) in 85 aa overlap (3-86:1-85)

               10        20        30        40        50        60        70         80        90       
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPI-IDGRKANVNLAYLGAKPRTNVQ
         :.  :    . :::.: ..:.:. :.  : .::.: .: .:.::.: .:::.:::..... . . : .  :   .:::.  :: :           
gnl|md   MAESDGAEYRCFVGSLSWNTDDRGLEAAFSSFGEILDAKIINDRETGRSRGFGFVSFSNEQAMQDAIEGMNGKELDGRSIVVNEAQSRGYGG    
                 10        20        30        40        50        60        70        80        90      

entry 16425, entity hrp1p                                                                                           (167 aa)
 initn: 169 init1: 169 opt: 181  Z-score: 227.3  bits: 47.6 E(): 9.4e-07
Smith-Waterman score: 181; 36.6% identity (69.5% similar) in 82 aa overlap (12-93:89-166)

                                                                10        20        30        40        50        60        70 
                                                        GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKD
                                                                   ::::::.   .  : ..:.: :.: : .: .. :..: .:::.::::. .  ...:.:. 
gnl|md TVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQHILDGKVIDPKRAIPRDEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYDSADAVDRVCQ-
       30        40        50        60        70        80        90       100       110       120       130       140        

              80        90       
       PNPIIDGRKANVNLAYLGAKPRTNVQ
        : .:: .  ....    :.::    
gnl|md -NKFIDFKDRKIEIKR--AEPRH   
        150       160            

entry 17706, entity SRSF2_RRM                                                                                       (135 aa)
 initn: 159 init1: 125 opt: 179  Z-score: 226.3  bits: 47.1 E(): 1.1e-06
Smith-Waterman score: 179; 34.9% identity (67.4% similar) in 86 aa overlap (11-95:48-133)

                                                    10        20        30        40        50        60        70         80  
                                            GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPN-PIIDGRKAN
                                                      :.. : .: :.::  ::.. ::..: . .. .  :: :..:::..:: ..:. .:: :    .  ..:::.  
gnl|md MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELR
               10        20        30        40        50        60        70        80        90       100       110       120

             90       
       VNLAYLGAKPRTNVQ
       :..:  :  : ..  
gnl|md VQMARYGRPPDSHHS
              130     

entry 17705, entity SRSF2_RRM                                                                                       (135 aa)
 initn: 159 init1: 125 opt: 179  Z-score: 226.3  bits: 47.1 E(): 1.1e-06
Smith-Waterman score: 179; 34.9% identity (67.4% similar) in 86 aa overlap (11-95:48-133)

                                                    10        20        30        40        50        60        70         80  
                                            GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPN-PIIDGRKAN
                                                      :.. : .: :.::  ::.. ::..: . .. .  :: :..:::..:: ..:. .:: :    .  ..:::.  
gnl|md MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELR
               10        20        30        40        50        60        70        80        90       100       110       120

             90       
       VNLAYLGAKPRTNVQ
       :..:  :  : ..  
gnl|md VQMARYGRPPDSHHS
              130     

entry 17707, entity SRSF2_RRM                                                                                       (135 aa)
 initn: 159 init1: 125 opt: 179  Z-score: 226.3  bits: 47.1 E(): 1.1e-06
Smith-Waterman score: 179; 34.9% identity (67.4% similar) in 86 aa overlap (11-95:48-133)

                                                    10        20        30        40        50        60        70         80  
                                            GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPN-PIIDGRKAN
                                                      :.. : .: :.::  ::.. ::..: . .. .  :: :..:::..:: ..:. .:: :    .  ..:::.  
gnl|md MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELR
               10        20        30        40        50        60        70        80        90       100       110       120

             90       
       VNLAYLGAKPRTNVQ
       :..:  :  : ..  
gnl|md VQMARYGRPPDSHHS
              130     

entry 16444, entity SC35                                                                                            (158 aa)
 initn: 159 init1: 125 opt: 179  Z-score: 225.3  bits: 47.2 E(): 1.2e-06
Smith-Waterman score: 179; 34.9% identity (67.4% similar) in 86 aa overlap (11-95:71-156)

                                                                 10        20        30        40        50        60        70
                                                         GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACK
                                                                   :.. : .: :.::  ::.. ::..: . .. .  :: :..:::..:: ..:. .:: :  
gnl|md TLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEGSHHHHHHMDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMD
               20        30        40        50        60        70        80        90       100       110       120       130

                80        90       
       DPN-PIIDGRKANVNLAYLGAKPRTNVQ
         .  ..:::.  :..:  :  : ..  
gnl|md AMDGAVLDGRELRVQMARYGRPPDSHHS
              140       150        

entry 25831, entity Rbfox_RRM                                                                                       (104 aa)
 initn:  77 init1:  77 opt: 160  Z-score: 205.6  bits: 42.9 E(): 1.5e-05
Smith-Waterman score: 160; 36.8% identity (71.1% similar) in 76 aa overlap (12-86:14-87)

                 10        20        30        40        50        60         70        80        90             
         GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERA-CKDPNPIIDGRKANVNLAYLGAKPRTNVQ      
                    .. :...:..  :  :...: ::: : .. .:   : . :.:.::::... :.:.::  :  . ...::: .:: :                 
gnl|md GSHMNTENKSQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIF--NERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKTVNPYTNG
               10        20        30        40          50        60        70        80        90       100    

entry 6895, entity Ataxin-2-binding protein 1                                                                       (109 aa)
 initn:  77 init1:  77 opt: 160  Z-score: 205.3  bits: 42.9 E(): 1.6e-05
Smith-Waterman score: 160; 36.8% identity (71.1% similar) in 76 aa overlap (12-86:31-104)

                                  10        20        30        40        50        60         70        80        90       
                          GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERA-CKDPNPIIDGRKANVNLAYLGAKPRTNVQ
                                     .. :...:..  :  :...: ::: : .. .:   : . :.:.::::... :.:.::  :  . ...::: .:: :           
gnl|md MGSSHHHHHHSSGLVPRGSHMNTENKSQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIF--NERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVM      
               10        20        30        40        50        60          70        80        90       100               

entry 15343, entity HR4730A                                                                                         (108 aa)
 initn: 139 init1: 139 opt: 156  Z-score: 200.7  bits: 42.1 E(): 2.9e-05
Smith-Waterman score: 156; 34.6% identity (64.2% similar) in 81 aa overlap (4-83:22-100)

                                 10        20        30        40        50        60        70         80        90       
                         GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPI-IDGRKANVNLAYLGAKPRTNVQ
                            ::   :  ...::.: .. ..  :.  :: :: ::   .. : .: .:.::::.:..:   :..: .. : . . ::  .:              
gnl|md MGHHHHHHSHMAAAMANNLQKGSAGPM--RLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQLNGFELAGRPMKVGHVTERTD      
               10        20          30        40        50        60        70        80        90       100              

entry 6315, entity TcUBP1                                                                                           (139 aa)
 initn: 129 init1: 129 opt: 157  Z-score: 200.3  bits: 42.4 E(): 3e-05
Smith-Waterman score: 157; 31.8% identity (69.3% similar) in 88 aa overlap (3-89:35-122)

                                               10        20        30        40        50        60        70         80       
                                       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPI-IDGRKANVNLAY
                                         :. .  .. ...:. .:  ...  :.. ::..: :: . .. ::.:..::::::: ... .::..:    : . : ... .: :: 
gnl|md MSQIPLVSQYDPYGQTAQLQQLQQQQQQHIPPTQMNPEPDVLRNLMVNYIPTTVDEVQLRQLFERYGPIESVKIVCDRETRQSRGYGFVKFQSGSSAQQAIAGLNGFNILNKRLKVALAA
               10        20        30        40        50        60        70        80        90       100       110       120

        90                
       LGAKPRTNVQ         
        :                 
gnl|md SGHQRPGIAGAVGDGNGYL
              130         

entry 16989, entity CYP33                                                                                           (83 aa)
 initn: 135 init1: 135 opt: 153  Z-score: 198.8  bits: 41.3 E(): 3.7e-05
Smith-Waterman score: 153; 38.7% identity (61.3% similar) in 75 aa overlap (13-86:8-82)

               10        20        30        40        50        60        70         80        90       
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPI-IDGRKANVNLAYLGAKPRTNVQ
                   ..::::  ...::.::  :  :::: .  .  : .:.: ::..:: ..   .:  :  . :   . ::   ::::           
gnl|md      GSTTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAK          
                    10        20        30        40        50        60        70        80             

entry 5774, entity Cleavage stimulation Factor 64, RRM domain                                                       (111 aa)
 initn: 143 init1: 143 opt: 153  Z-score: 197.0  bits: 41.4 E(): 4.6e-05
Smith-Waterman score: 153; 30.9% identity (64.2% similar) in 81 aa overlap (7-86:12-92)

                    10        20        30        40        50        60        70         80        90               
            GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPI-IDGRKANVNLAYLGAKPRTNVQ        
                  :  . ..:::..::..... :.. : . : .    .. ::.: : .::::  ..:. .:  : .. :   ..::   :. :                   
gnl|md MAGLTVRDPAVDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGTGAPVI
               10        20        30        40        50        60        70        80        90       100       110 

entry 25449, entity RRM                                                                                             (89 aa)
 initn: 124 init1: 124 opt: 149  Z-score: 193.7  bits: 40.5 E(): 7e-05
Smith-Waterman score: 149; 30.6% identity (67.1% similar) in 85 aa overlap (1-84:1-85)

               10        20        30        40        50        60        70         80        90       
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPI-IDGRKANVNLAYLGAKPRTNVQ
       :.  : ..    .::::.    ..:.:.. : .::::..  :  . .:.:.::..:: . .  .:..:  . : . ..:.. .::             
gnl|md GSHMSDNNATDILFVGGIDETIDEKSLYDIFSSFGDIRNIEVPLNMTTKKNRGFAFVEYVEVDDAKHALYNMNNFELNGKRIHVNYSKT         
               10        20        30        40        50        60        70        80                  

entry 19609, entity entity_1                                                                                        (94 aa)
 initn: 109 init1:  76 opt: 148  Z-score: 192.2  bits: 40.3 E(): 8.5e-05
Smith-Waterman score: 148; 34.2% identity (68.4% similar) in 76 aa overlap (12-86:6-79)

               10        20        30        40        50        60        70         80        90           
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPN-PIIDGRKANVNLAYLGAKPRTNVQ    
                  .. :...:..  .  :  .::. : . .. .:   : . :.:.:::::..  .:.::  . :   :.::...::::               
gnl|md       GDGPRRLHVSNIPFKYREPDLTAMFEKVGPVVDVEIIF--NERGSKGFGFVTMQNPDDADRARAEFNGTTIEGRRVEVNLATQRVHNKKAKPLMSV
                     10        20        30          40        50        60        70        80        90    

entry 19680, entity ASD-1                                                                                           (99 aa)
 initn: 109 init1:  76 opt: 148  Z-score: 191.8  bits: 40.3 E(): 8.9e-05
Smith-Waterman score: 148; 34.2% identity (68.4% similar) in 76 aa overlap (12-86:23-96)

                          10        20        30        40        50        60        70         80        90       
                  GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPN-PIIDGRKANVNLAYLGAKPRTNVQ
                             .. :...:..  .  :  .::. : . .. .:   : . :.:.:::::..  .:.::  . :   :.::...::::           
gnl|md GAMGPVAPNDRSTSSSSTDGPRRLHVSNIPFKYREPDLTAMFEKVGPVVDVEIIF--NERGSKGFGFVTMQNPDDADRARAEFNGTTIEGRRVEVNLATQR        
               10        20        30        40        50          60        70        80        90                 

entry 19686, entity ASD-1                                                                                           (99 aa)
 initn: 109 init1:  76 opt: 148  Z-score: 191.8  bits: 40.3 E(): 8.9e-05
Smith-Waterman score: 148; 34.2% identity (68.4% similar) in 76 aa overlap (12-86:23-96)

                          10        20        30        40        50        60        70         80        90       
                  GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPN-PIIDGRKANVNLAYLGAKPRTNVQ
                             .. :...:..  .  :  .::. : . .. .:   : . :.:.:::::..  .:.::  . :   :.::...::::           
gnl|md GAMGPVAPNDRSTSSSSTDGPRRLHVSNIPFKYREPDLTAMFEKVGPVVDVEIIF--NERGSKGFGFVTMQNPDDADRARAEFNGTTIEGRRVEVNLATQR        
               10        20        30        40        50          60        70        80        90                 

entry 18765, entity RRM1                                                                                            (103 aa)
 initn: 128 init1: 128 opt: 147  Z-score: 190.4  bits: 40.1 E(): 0.00011
Smith-Waterman score: 147; 32.9% identity (67.1% similar) in 82 aa overlap (4-85:11-89)

                      10        20        30        40        50        60        70        80        90         
              GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ  
                 ::. :  . ..: :::..:... :.:::  ::..  . :  : .: .:.:.::: . .  .  .. .. . .::::  . .:              
gnl|md MRGSHHHHHHGSQKT--SDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRH-MIDGRWCDCKLPNSKQSQDEPLRSR
               10          20        30        40        50        60        70         80        90       100   

entry 19064, entity TIAR_RRM2                                                                                       (101 aa)
 initn: 134 init1: 134 opt: 146  Z-score: 189.4  bits: 39.9 E(): 0.00012
Smith-Waterman score: 146; 32.2% identity (58.6% similar) in 87 aa overlap (1-86:7-93)

                     10        20        30        40        50        60         70        80        90       
             GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERA-CKDPNPIIDGRKANVNLAYLGAKPRTNVQ
             :. :.  .   ..::: :  . . . ..  :  :: : .: :. :  : ::.:::::.. .. .:: :  .  .  . ::.  .: :           
gnl|md GSPGISGGGGGIPSNHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPK   
               10        20        30        40        50        60        70        80        90       100    

entry 19063, entity TIAR_RRM2                                                                                       (101 aa)
 initn: 134 init1: 134 opt: 146  Z-score: 189.4  bits: 39.9 E(): 0.00012
Smith-Waterman score: 146; 32.2% identity (58.6% similar) in 87 aa overlap (1-86:7-93)

                     10        20        30        40        50        60         70        80        90       
             GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERA-CKDPNPIIDGRKANVNLAYLGAKPRTNVQ
             :. :.  .   ..::: :  . . . ..  :  :: : .: :. :  : ::.:::::.. .. .:: :  .  .  . ::.  .: :           
gnl|md GSPGISGGGGGIPSNHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPK   
               10        20        30        40        50        60        70        80        90       100    

entry 4711, entity RNA-binding protein                                                                              (101 aa)
 initn: 126 init1: 126 opt: 144  Z-score: 187.0  bits: 39.4 E(): 0.00017
Smith-Waterman score: 144; 33.3% identity (61.9% similar) in 84 aa overlap (13-95:2-81)

               10        20        30        40        50        60        70        80         90                         
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRK-ANVNLAYLGAKPRTNVQ                  
                   :.::.: :.... ::   : ..: .... . :::.: . ::.::: : ..:    : .     .:: .  . .:    :::: .                    
gnl|md            SIYVGNLSYEVTQDTLSAVFAEYGTVKRVQLPTDRETGQPRGFGFVEMGSEAEEAAAIE----ALDGAEWMGRDLKVNKAKPREDRGPSGGNRGGYGGGGGRNRY
                          10        20        30        40        50            60        70        80        90       100 

entry 11374, entity RRM domain                                                                                      (115 aa)
 initn: 130 init1: 130 opt: 144  Z-score: 186.2  bits: 39.5 E(): 0.00018
Smith-Waterman score: 144; 33.7% identity (60.7% similar) in 89 aa overlap (1-86:4-92)

                    10        20        30        40        50        60        70         80        90                   
          GAMGSR-DTM-FTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKD-PNPIIDGRKANVNLAYLGAKPRTNVQ            
          :. :.. ::    ..::: :  . . . ..  :  :: : .: :. :  : ::.:::::.. .. .:: : ..  .  . ::.  .: :                       
gnl|md GSSGSSGQKKDTSNHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQSGPSSG
               10        20        30        40        50        60        70        80        90       100       110     

entry 11376, entity RRM domain                                                                                      (115 aa)
 initn: 130 init1: 130 opt: 144  Z-score: 186.2  bits: 39.5 E(): 0.00018
Smith-Waterman score: 144; 33.7% identity (60.7% similar) in 89 aa overlap (1-86:4-92)

                    10        20        30        40        50        60        70         80        90                   
          GAMGSR-DTM-FTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKD-PNPIIDGRKANVNLAYLGAKPRTNVQ            
          :. :.. ::    ..::: :  . . . ..  :  :: : .: :. :  : ::.:::::.. .. .:: : ..  .  . ::.  .: :                       
gnl|md GSSGSSGQKKDTSNHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQSGPSSG
               10        20        30        40        50        60        70        80        90       100       110     

entry 11375, entity RRM domain                                                                                      (115 aa)
 initn: 130 init1: 130 opt: 144  Z-score: 186.2  bits: 39.5 E(): 0.00018
Smith-Waterman score: 144; 33.7% identity (60.7% similar) in 89 aa overlap (1-86:4-92)

                    10        20        30        40        50        60        70         80        90                   
          GAMGSR-DTM-FTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKD-PNPIIDGRKANVNLAYLGAKPRTNVQ            
          :. :.. ::    ..::: :  . . . ..  :  :: : .: :. :  : ::.:::::.. .. .:: : ..  .  . ::.  .: :                       
gnl|md GSSGSSGQKKDTSNHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQSGPSSG
               10        20        30        40        50        60        70        80        90       100       110     

entry 11370, entity RRM domain C terminal truncated                                                                 (87 aa)
 initn: 130 init1: 130 opt: 142  Z-score: 185.6  bits: 39.0 E(): 0.0002
Smith-Waterman score: 142; 34.7% identity (61.3% similar) in 75 aa overlap (13-86:12-86)

               10        20        30        40        50        60        70         80        90       
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKD-PNPIIDGRKANVNLAYLGAKPRTNVQ
                   .::: :  . . . ..  :  :: : .: :. :  : ::.:::::.. .. .:: : ..  .  . ::.  .: :           
gnl|md  GQKKDTSNHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWAT          
                10        20        30        40        50        60        70        80                 

entry 19290, entity TAR_DNA-BINDING_PROTEIN_43                                                                      (174 aa)
 initn: 128 init1: 128 opt: 143  Z-score: 182.5  bits: 39.4 E(): 0.0003
Smith-Waterman score: 143; 32.0% identity (68.0% similar) in 75 aa overlap (11-85:9-82)

               10        20        30        40        50        60        70        80        90                              
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ                       
                 . ..: :::..:... :.:::  ::..  . :  : .: .:.:.::: . .  .  .. .. . .::::  . .:                                   
gnl|md   GSHMASKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRH-MIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFS
                 10        20        30        40        50        60        70         80        90       100       110       

gnl|md QYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQ
       120       130       140       150       160       170    

entry 19735, entity TIA-1_RRM2,3                                                                                    (185 aa)
 initn: 130 init1: 130 opt: 142  Z-score: 180.9  bits: 39.2 E(): 0.00036
Smith-Waterman score: 142; 34.7% identity (61.3% similar) in 75 aa overlap (13-86:8-82)

               10        20        30        40        50        60        70         80        90                             
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKD-PNPIIDGRKANVNLAYLGAKPRTNVQ                      
                   .::: :  . . . ..  :  :: : .: :. :  : ::.:::::.. .. .:: : ..  .  . ::.  .: :                                 
gnl|md      AMANHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSSPSNCT
                    10        20        30        40        50        60        70        80        90       100       110     

gnl|md VYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGK
         120       130       140       150       160       170       180     

entry 6121, entity CUG-BP                                                                                           (187 aa)
 initn: 151 init1: 107 opt: 142  Z-score: 180.9  bits: 39.2 E(): 0.00036
Smith-Waterman score: 142; 44.1% identity (64.4% similar) in 59 aa overlap (12-68:17-75)

                    10        20        30        40          50        60        70        80        90                       
            GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDR--NTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ                
                       :.::: .:   :.: :.: :::.: . :  :. ::  :  .:.:  :::.  : .: .:                                             
gnl|md MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCT
               10        20        30        40        50        60        70        80        90       100       110       120

gnl|md ENDIRVMFSSFGQIEECRILRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFAD
              130       140       150       160       170       180       

entry 11372, entity RRM domain K138A mutant                                                                         (103 aa)
 initn: 125 init1: 125 opt: 137  Z-score: 178.7  bits: 37.9 E(): 0.00048
Smith-Waterman score: 137; 34.7% identity (60.0% similar) in 75 aa overlap (13-86:12-86)

               10        20        30        40        50        60        70         80        90             
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKD-PNPIIDGRKANVNLAYLGAKPRTNVQ      
                   .::: :  . . . ..  :  :: : .: :. :  : :: :::::.. .. .:: : ..  .  . ::.  .: :                 
gnl|md  GQKKDTSNHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSAGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQ
                10        20        30        40        50        60        70        80        90       100   

entry 11373, entity RRM domain T134A mutant                                                                         (103 aa)
 initn: 125 init1: 125 opt: 137  Z-score: 178.7  bits: 37.9 E(): 0.00048
Smith-Waterman score: 137; 33.3% identity (61.3% similar) in 75 aa overlap (13-86:12-86)

               10        20        30        40        50        60        70         80        90             
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKD-PNPIIDGRKANVNLAYLGAKPRTNVQ      
                   .::: :  . . . ..  :  :: : .: :. :  . ::.:::::.. .. .:: : ..  .  . ::.  .: :                 
gnl|md  GQKKDTSNHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMAAGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQ
                10        20        30        40        50        60        70        80        90       100   

entry 5764, entity ALY                                                                                              (106 aa)
 initn:  87 init1:  87 opt: 137  Z-score: 178.5  bits: 37.9 E(): 0.00049
Smith-Waterman score: 137; 34.7% identity (69.3% similar) in 75 aa overlap (12-85:30-103)

                                 10        20        30        40        50        60        70         80        90       
                         GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPI-IDGRKANVNLAYLGAKPRTNVQ
                                    :..:..: . .::  ..: : .:: ...:.:  :: . .: : . : .. .:.: .: :. : . .:::  :..:            
gnl|md SRPKQLPDKWQHDLFDSGFGGGAGVETGGKLLVSNLDFGVSDADIQELFAEFGTLKKAAVHYDR-SGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTS         
               10        20        30        40        50        60         70        80        90       100               

entry 15942, entity PABP1                                                                                           (95 aa)
 initn: 112 init1:  67 opt: 134  Z-score: 175.7  bits: 37.3 E(): 0.00071
Smith-Waterman score: 134; 34.2% identity (62.0% similar) in 79 aa overlap (6-83:7-83)

                10        20        30        40        50        60        70         80        90       
        GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPII-DGRKANVNLAYLGAKPRTNVQ
             : .   .::. .:    ..:.:.. :  ::.:    :. :.:   :.::::: .. . .:::: .  : .. . ::. :              
gnl|md GADPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG--SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAE  
               10        20        30        40          50        60        70        80        90       

entry 17622, entity HUMAN_U2AF65                                                                                    (198 aa)
 initn:  96 init1:  96 opt: 136  Z-score: 173.5  bits: 37.9 E(): 0.00094
Smith-Waterman score: 136; 32.1% identity (59.3% similar) in 81 aa overlap (12-91:116-196)

                                                                10        20        30        40        50        60        70 
                                                        GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKD
                                                                   :.:.:::: . .:  ..: . .:: ..   .. :  :  :.::.:  . :   ...:   
gnl|md LEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAG
          60        70        80        90       100       110       120       130       140       150       160       170     

               80        90       
       PNPIIDG-RKANVNLAYLGAKPRTNVQ
        : .  : .:  :. : .:::      
gnl|md LNGMQLGDKKLLVQRASVGAKNA    
         180       190            

entry 17623, entity HUMAN_U2AF65                                                                                    (198 aa)
 initn:  96 init1:  96 opt: 136  Z-score: 173.5  bits: 37.9 E(): 0.00094
Smith-Waterman score: 136; 32.1% identity (59.3% similar) in 81 aa overlap (12-91:116-196)

                                                                10        20        30        40        50        60        70 
                                                        GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKD
                                                                   :.:.:::: . .:  ..: . .:: ..   .. :  :  :.::.:  . :   ...:   
gnl|md LEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAG
          60        70        80        90       100       110       120       130       140       150       160       170     

               80        90       
       PNPIIDG-RKANVNLAYLGAKPRTNVQ
        : .  : .:  :. : .:::      
gnl|md LNGMQLGDKKLLVQRASVGAKNA    
         180       190            

entry 11371, entity RRM domain D131A mutant                                                                         (103 aa)
 initn: 120 init1: 120 opt: 132  Z-score: 172.8  bits: 36.8 E(): 0.001
Smith-Waterman score: 132; 33.3% identity (60.0% similar) in 75 aa overlap (13-86:12-86)

               10        20        30        40        50        60        70         80        90             
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKD-PNPIIDGRKANVNLAYLGAKPRTNVQ      
                   .::: :  . . . ..  :  :: : .: :.    : ::.:::::.. .. .:: : ..  .  . ::.  .: :                 
gnl|md  GQKKDTSNHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKAMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQ
                10        20        30        40        50        60        70        80        90       100   

entry 11408, entity RNA RECOGNITION MOTIF, RESIDUES 383-484                                                         (115 aa)
 initn: 116 init1: 116 opt: 132  Z-score: 172.2  bits: 36.9 E(): 0.0011
Smith-Waterman score: 132; 31.7% identity (63.4% similar) in 82 aa overlap (1-80:14-95)

                              10        20        30        40        50        60        70        80        90          
                    GAMGSRDT--MFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ   
                    :: ::.      ...:.  :: . .:. : ..:  ::..  : :. :..:. :. .:::.. . .::. : .. : .  : :                    
gnl|md GSSGSSGLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDSKSGPSSG
               10        20        30        40        50        60        70        80        90       100       110     

entry 11407, entity RNA recognition motif                                                                           (115 aa)
 initn: 116 init1: 116 opt: 132  Z-score: 172.2  bits: 36.9 E(): 0.0011
Smith-Waterman score: 132; 31.7% identity (63.4% similar) in 82 aa overlap (1-80:14-95)

                              10        20        30        40        50        60        70        80        90          
                    GAMGSRDT--MFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ   
                    :: ::.      ...:.  :: . .:. : ..:  ::..  : :. :..:. :. .:::.. . .::. : .. : .  : :                    
gnl|md GSSGSSGLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDSKSGPSSG
               10        20        30        40        50        60        70        80        90       100       110     

entry 11406, entity RNA recognition motif                                                                           (115 aa)
 initn: 116 init1: 116 opt: 132  Z-score: 172.2  bits: 36.9 E(): 0.0011
Smith-Waterman score: 132; 31.7% identity (63.4% similar) in 82 aa overlap (1-80:14-95)

                              10        20        30        40        50        60        70        80        90          
                    GAMGSRDT--MFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ   
                    :: ::.      ...:.  :: . .:. : ..:  ::..  : :. :..:. :. .:::.. . .::. : .. : .  : :                    
gnl|md GSSGSSGLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDSKSGPSSG
               10        20        30        40        50        60        70        80        90       100       110     

entry 11405, entity RNA recognition motif                                                                           (115 aa)
 initn: 116 init1: 116 opt: 132  Z-score: 172.2  bits: 36.9 E(): 0.0011
Smith-Waterman score: 132; 31.7% identity (63.4% similar) in 82 aa overlap (1-80:14-95)

                              10        20        30        40        50        60        70        80        90          
                    GAMGSRDT--MFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ   
                    :: ::.      ...:.  :: . .:. : ..:  ::..  : :. :..:. :. .:::.. . .::. : .. : .  : :                    
gnl|md GSSGSSGLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDSKSGPSSG
               10        20        30        40        50        60        70        80        90       100       110     

entry 16708, entity BRUNOL-3                                                                                        (199 aa)
 initn: 142 init1:  97 opt: 132  Z-score: 168.8  bits: 37.0 E(): 0.0017
Smith-Waterman score: 132; 40.7% identity (62.7% similar) in 59 aa overlap (12-68:17-75)

                    10        20        30        40          50        60        70        80        90                       
            GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDR--NTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ                
                       :.::: .:   :.: :.: :: .: . .  :. ::  :  .:.:  :::.  : .: .:                                             
gnl|md MNGALDHSDQPDPDAIKMFVGQIPRSWSEKELKELFEPYGAVYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLFIGMVSKKCN
               10        20        30        40        50        60        70        80        90       100       110       120

gnl|md ENDIRVMFSPFGQIEECRILRGPDGLSRGCAFVTFSTRAMAQNAIKAMHQSQTMEGCSSPIVVKFADTQKDKEQRRLQQ
              130       140       150       160       170       180       190         

entry 16683, entity REF_54-155                                                                                      (124 aa)
 initn:  87 init1:  87 opt: 129  Z-score: 168.2  bits: 36.3 E(): 0.0019
Smith-Waterman score: 129; 33.3% identity (69.3% similar) in 75 aa overlap (12-85:37-110)

                                        10        20        30        40        50        60        70         80        90    
                                GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPI-IDGRKANVNLAYLGAKPRT
                                           :..:..: . .::  ..: : .:: ...:.:  :: . .: : . : .. ::.: .: :. . . .:::  ...:         
gnl|md MASMTGGQQMGRDPDKWQHDLFDSGCGGGEGVETGAKLLVSNLDFGVSDADIQELFAEFGTLKKAAVDYDR-SGRSLGTADVHFERRADALKAMKQYKGVPLDGRPMDIQLVASQIDLEH
               10        20        30        40        50        60        70         80        90       100       110         

            
       NVQ  
            
gnl|md HHHHH
     120    

entry 17693, entity RNA_AND_EXPORT_FACTOR-BINDING_PROTEIN_2                                                         (124 aa)
 initn:  87 init1:  87 opt: 129  Z-score: 168.2  bits: 36.3 E(): 0.0019
Smith-Waterman score: 129; 33.3% identity (69.3% similar) in 75 aa overlap (12-85:37-110)

                                        10        20        30        40        50        60        70         80        90    
                                GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPI-IDGRKANVNLAYLGAKPRT
                                           :..:..: . .::  ..: : .:: ...:.:  :: . .: : . : .. ::.: .: :. . . .:::  ...:         
gnl|md MASMTGGQQMGRDPDKWQHDLFDSGCGGGEGVETGAKLLVSNLDFGVSDADIQELFAEFGTLKKAAVDYDR-SGRSLGTADVHFERRADALKAMKQYKGVPLDGRPMDIQLVASQIDLEH
               10        20        30        40        50        60        70         80        90       100       110         

            
       NVQ  
            
gnl|md HHHHH
     120    

entry 7435, entity REF_54-155                                                                                       (124 aa)
 initn:  87 init1:  87 opt: 129  Z-score: 168.2  bits: 36.3 E(): 0.0019
Smith-Waterman score: 129; 33.3% identity (69.3% similar) in 75 aa overlap (12-85:37-110)

                                        10        20        30        40        50        60        70         80        90    
                                GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPI-IDGRKANVNLAYLGAKPRT
                                           :..:..: . .::  ..: : .:: ...:.:  :: . .: : . : .. ::.: .: :. . . .:::  ...:         
gnl|md MASMTGGQQMGRDPDKWQHDLFDSGCGGGEGVETGAKLLVSNLDFGVSDADIQELFAEFGTLKKAAVDYDR-SGRSLGTADVHFERRADALKAMKQYKGVPLDGRPMDIQLVASQIDLEH
               10        20        30        40        50        60        70         80        90       100       110         

            
       NVQ  
            
gnl|md HHHHH
     120    

entry 16697, entity REF_54-155                                                                                      (124 aa)
 initn:  87 init1:  87 opt: 129  Z-score: 168.2  bits: 36.3 E(): 0.0019
Smith-Waterman score: 129; 33.3% identity (69.3% similar) in 75 aa overlap (12-85:37-110)

                                        10        20        30        40        50        60        70         80        90    
                                GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPI-IDGRKANVNLAYLGAKPRT
                                           :..:..: . .::  ..: : .:: ...:.:  :: . .: : . : .. ::.: .: :. . . .:::  ...:         
gnl|md MASMTGGQQMGRDPDKWQHDLFDSGCGGGEGVETGAKLLVSNLDFGVSDADIQELFAEFGTLKKAAVDYDR-SGRSLGTADVHFERRADALKAMKQYKGVPLDGRPMDIQLVASQIDLEH
               10        20        30        40        50        60        70         80        90       100       110         

            
       NVQ  
            
gnl|md HHHHH
     120    

entry 7023, entity REF2-I residues 1-155                                                                            (177 aa)
 initn:  87 init1:  87 opt: 129  Z-score: 166.0  bits: 36.4 E(): 0.0025
Smith-Waterman score: 129; 33.3% identity (69.3% similar) in 75 aa overlap (12-85:90-163)

                                                                10        20        30        40        50        60        70 
                                                        GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKD
                                                                   :..:..: . .::  ..: : .:: ...:.:  :: . .: : . : .. ::.: .: :.
gnl|md NRNQRRVNRGGGPRRNRPAIARGGRNRPAPYSRPKPLPDKWQHDLFDSGCGGGEGVETGAKLLVSNLDFGVSDADIQELFAEFGTLKKAAVDYDR-SGRSLGTADVHFERRADALKAMKQ
      30        40        50        60        70        80        90       100       110       120        130       140        

               80        90         
       PNPI-IDGRKANVNLAYLGAKPRTNVQ  
        . . .:::  ...:              
gnl|md YKGVPLDGRPMDIQLVASQIDLEHHHHHH
      150       160       170       

entry 25072, entity Sex-lethal_(SXL)                                                                                (176 aa)
 initn:  45 init1:  45 opt: 128  Z-score: 164.8  bits: 36.1 E(): 0.0028
Smith-Waterman score: 128; 30.4% identity (62.0% similar) in 92 aa overlap (1-91:1-88)

               10        20        30        40        50        60        70         80        90                             
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPI-IDGRKANVNLAYLGAKPRTNVQ                      
       :::.:     :...:. ::   .:. :.  :. .: :.   .. : .:  : ::.:: . .. ...:: :  : : . ... .:. :  :..                            
gnl|md GAMASN----TNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKY
                   10        20        30        40        50        60        70        80        90       100       110      

gnl|md GSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLAEEHGK
        120       130       140       150       160       170      

entry 4028, entity Sex-lethal protein                                                                               (184 aa)
 initn:  45 init1:  45 opt: 128  Z-score: 164.6  bits: 36.2 E(): 0.0029
Smith-Waterman score: 128; 30.2% identity (59.4% similar) in 96 aa overlap (3-91:1-96)

               10              20        30        40        50        60        70         80        90                       
       GAMGSRDTMF------TKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPI-IDGRKANVNLAYLGAKPRTNVQ                
         ::: : :       :...:. ::   .:. :.  :. .: :.   .. : .:  : ::.:: . .. ...:: :  : : . ... .:. :  :..                      
gnl|md   MGSDDLMNDPRASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTITDDQLD
                 10        20        30        40        50        60        70        80        90       100       110        

gnl|md TIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLAEEHGK
      120       130       140       150       160       170       180    

entry 4029, entity Sex-lethal protein                                                                               (184 aa)
 initn:  45 init1:  45 opt: 128  Z-score: 164.6  bits: 36.2 E(): 0.0029
Smith-Waterman score: 128; 30.2% identity (59.4% similar) in 96 aa overlap (3-91:1-96)

               10              20        30        40        50        60        70         80        90                       
       GAMGSRDTMF------TKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPI-IDGRKANVNLAYLGAKPRTNVQ                
         ::: : :       :...:. ::   .:. :.  :. .: :.   .. : .:  : ::.:: . .. ...:: :  : : . ... .:. :  :..                      
gnl|md   MGSDDLMNDPRASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTITDDQLD
                 10        20        30        40        50        60        70        80        90       100       110        

gnl|md TIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLAEEHGK
      120       130       140       150       160       170       180    

entry 36018, entity Splicing factor 3B subunit 4                                                                    (105 aa)
 initn: 107 init1: 107 opt: 125  Z-score: 164.5  bits: 35.3 E(): 0.003
Smith-Waterman score: 125; 33.3% identity (58.6% similar) in 87 aa overlap (1-86:7-92)

                     10        20        30        40        50        60        70         80        90         
             GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPI-IDGRKANVNLAYLGAKPRTNVQ  
             : .. :.   : ..::::  ..:.  : : : : : . .. .  :: : . .::::: . .. .:. : :  . : . :.   :: :             
gnl|md GSSGSSGPISERNQDAT-VYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMDMIKLYGKPIRVNKASAHNKNLSGPSSG
               10         20        30        40        50        60        70        80        90       100     

entry 27155, entity entity_1                                                                                        (114 aa)
 initn: 108 init1: 108 opt: 125  Z-score: 164.0  bits: 35.4 E(): 0.0032
Smith-Waterman score: 125; 30.9% identity (66.2% similar) in 68 aa overlap (13-80:31-98)

                                 10        20        30        40        50        60        70        80        90       
                         GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ
                                     .:.. :: . .:. . ..:  ::..  : :. :..:. :. .:::.. . .::. : .  : .  : :                 
gnl|md MGSSHHHHHHSSGLVPRGSHMQKEGPEGANLFIAHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSKPW 
               10        20        30        40        50        60        70        80        90       100       110     

entry 27142, entity entity_1                                                                                        (114 aa)
 initn: 108 init1: 108 opt: 125  Z-score: 164.0  bits: 35.4 E(): 0.0032
Smith-Waterman score: 125; 30.9% identity (66.2% similar) in 68 aa overlap (13-80:31-98)

                                 10        20        30        40        50        60        70        80        90       
                         GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ
                                     .:.. :: . .:. . ..:  ::..  : :. :..:. :. .:::.. . .::. : .  : .  : :                 
gnl|md MGSSHHHHHHSSGLVPRGSHMQKEGPEGANLFIAHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSKPW 
               10        20        30        40        50        60        70        80        90       100       110     

entry 26628, entity HuR                                                                                             (193 aa)
 initn: 117 init1: 117 opt: 127  Z-score: 163.1  bits: 36.0 E(): 0.0036
Smith-Waterman score: 128; 31.1% identity (63.3% similar) in 90 aa overlap (7-96:23-109)

                               10        20        30        40        50        60        70        80        90              
                       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ       
                             :   :...:. :: . ..  :.  : ..:..: : .: :. . .: :::::..    .:::: .  : .    :. ....:  :.: ..:        
gnl|md MHHHHHHMSNGYEDHMAEDCRGDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVTAKDAERAINTLNGLRLQSKT-IKVSY--ARPSSEVIKDANLYI
               10        20        30        40        50        60        70        80        90        100         110       

gnl|md SGLPRTMTQKDVEDMFSRFGRIINSRVLVDQTTGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPITVKFAAN
       120       130       140       150       160       170       180       190   

entry 27156, entity entity_1                                                                                        (114 aa)
 initn: 108 init1: 108 opt: 124  Z-score: 162.8  bits: 35.1 E(): 0.0037
Smith-Waterman score: 124; 30.9% identity (66.2% similar) in 68 aa overlap (13-80:31-98)

                                 10        20        30        40        50        60        70        80        90       
                         GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ
                                     .:. .:: . .:. . ..:  ::..  : :. :..:. :. .:::.. . .::. : .  : .  : :                 
gnl|md MGSSHHHHHHSSGLVPRGSHMQKEGPEGANLFIYALPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSKPW 
               10        20        30        40        50        60        70        80        90       100       110     

entry 27152, entity entity_1                                                                                        (114 aa)
 initn: 108 init1: 108 opt: 124  Z-score: 162.8  bits: 35.1 E(): 0.0037
Smith-Waterman score: 124; 30.9% identity (66.2% similar) in 68 aa overlap (13-80:31-98)

                                 10        20        30        40        50        60        70        80        90       
                         GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ
                                     .:. .:: . .:. . ..:  ::..  : :. :..:. :. .:::.. . .::. : .  : .  : :                 
gnl|md MGSSHHHHHHSSGLVPRGSHMQKEGPEGANLFIYALPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSKPW 
               10        20        30        40        50        60        70        80        90       100       110     

entry 27002, entity HuR_RRM1-RRM2                                                                                   (210 aa)
 initn: 117 init1: 117 opt: 127  Z-score: 162.6  bits: 36.0 E(): 0.0038
Smith-Waterman score: 128; 31.1% identity (63.3% similar) in 90 aa overlap (7-96:16-102)

                        10        20        30        40        50        60        70        80        90                     
                GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ              
                      :   :...:. :: . ..  :.  : ..:..: : .: :. . .: :::::..    .:::: .  : .    :. ....:  :.: ..:               
gnl|md MSNGYEDHMAEDCRGDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVTAKDAERAINTLNGLRLQSKT-IKVSY--ARPSSEVIKDANLYISGLPRTM
               10        20        30        40        50        60        70        80        90          100       110       

gnl|md TQKDVEDMFSRFGRIINSRVLVDQTTGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPIAVKFAANPNQNKNVALLSPRAPPPPPPPLID
       120       130       140       150       160       170       180       190       200       210

entry 19499, entity HUR_RRM3_W261E_mutant                                                                           (124 aa)
 initn: 123 init1: 123 opt: 124  Z-score: 162.3  bits: 35.2 E(): 0.0039
Smith-Waterman score: 124; 35.3% identity (58.8% similar) in 68 aa overlap (13-80:44-111)

                                              10        20        30        40        50        60        70        80         
                                      GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLG
                                                  ::. .:   ...  :...:  :: . .. :: : ::.: .:.::::: .   :  :  . :    : :         
gnl|md MKHHHHHHPMSDYDIPTTEISGRENLYFQSGSEFPAETPSGWCIFIYNLGQDADEGILEQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVSFKTN
               10        20        30        40        50        60        70        80        90       100       110       120

      90       
       AKPRTNVQ
               
gnl|md KSHK    
               

entry 16884, entity RRM3                                                                                            (97 aa)
 initn: 108 init1: 108 opt: 122  Z-score: 161.5  bits: 34.7 E(): 0.0044
Smith-Waterman score: 122; 30.9% identity (64.7% similar) in 68 aa overlap (13-80:14-81)

                10        20        30        40        50        60        70        80        90       
        GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ
                    .:.  :: . .:. . ..:  ::..  : :. :..:. :. .:::.. . .::. : .  : .  : :                 
gnl|md GSHMQKEGPEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSKPY 
               10        20        30        40        50        60        70        80        90        

entry 19685, entity entity                                                                                          (97 aa)
 initn: 108 init1: 108 opt: 122  Z-score: 161.5  bits: 34.7 E(): 0.0044
Smith-Waterman score: 122; 30.9% identity (64.7% similar) in 68 aa overlap (13-80:14-81)

                10        20        30        40        50        60        70        80        90       
        GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ
                    .:.  :: . .:. . ..:  ::..  : :. :..:. :. .:::.. . .::. : .  : .  : :                 
gnl|md GSHMQKEGPEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSKPY 
               10        20        30        40        50        60        70        80        90        

entry 11458, entity entity                                                                                          (99 aa)
 initn:  66 init1:  66 opt: 122  Z-score: 161.4  bits: 34.7 E(): 0.0044
Smith-Waterman score: 122; 26.7% identity (62.2% similar) in 90 aa overlap (1-86:4-86)

                  10          20        30        40        50        60          70        80        90         
          GAMGSRDTMF--TKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAE--RACKDPNPIIDGRKANVNLAYLGAKPRTNVQ  
          :. :.. :.   ...:::.::   ... ... ::..:   :. .      .:..:.::. .. :. ::  ..  :  :.  :..  : .:             
gnl|md GSSGSSGGEKTFTQRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFI------HKDKGFGFIRLETRTLAEIAKVELDNMPL-RGKQLRVRFACHSASLTSGPSSG
               10        20        30        40              50        60        70         80        90         

entry 25244, entity HuR_RRM1                                                                                        (101 aa)
 initn: 102 init1:  61 opt: 122  Z-score: 161.2  bits: 34.7 E(): 0.0045
Smith-Waterman score: 122; 30.9% identity (64.2% similar) in 81 aa overlap (7-86:18-98)

                          10        20        30        40        50        60        70         80        90       
                  GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPI-IDGRKANVNLAYLGAKPRTNVQ
                        :   :...:. :: . ..  :.  : ..:..: : .: :. . .: :::::..    .:::: .  : . ....  .:. :           
gnl|md GHMSNGYEDHMAEDCRGDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVTAKDAERAINTLNGLRLQSKTIKVSYARPS        
               10        20        30        40        50        60        70        80        90       100         

entry 30155, entity entity_1                                                                                        (101 aa)
 initn: 102 init1:  61 opt: 122  Z-score: 161.2  bits: 34.7 E(): 0.0045
Smith-Waterman score: 122; 30.9% identity (64.2% similar) in 81 aa overlap (7-86:18-98)

                          10        20        30        40        50        60        70         80        90       
                  GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPI-IDGRKANVNLAYLGAKPRTNVQ
                        :   :...:. :: . ..  :.  : ..:..: : .: :. . .: :::::..    .:::: .  : . ....  .:. :           
gnl|md GHMSNGYEDHMAEDCRGDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVTAKDAERAINTLNGLRLQSKTIKVSYARPS        
               10        20        30        40        50        60        70        80        90       100         

entry 34057, entity CUGBP Elav-like family member 2                                                                 (114 aa)
 initn: 108 init1: 108 opt: 122  Z-score: 160.5  bits: 34.7 E(): 0.005
Smith-Waterman score: 122; 30.9% identity (64.7% similar) in 68 aa overlap (13-80:31-98)

                                 10        20        30        40        50        60        70        80        90       
                         GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ
                                     .:.  :: . .:. . ..:  ::..  : :. :..:. :. .:::.. . .::. : .  : .  : :                 
gnl|md MGSSHHHHHHSSGLVPRGSHMQKEGPEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSKPW 
               10        20        30        40        50        60        70        80        90       100       110     

entry 27140, entity CUG_BP2_RRM3                                                                                    (114 aa)
 initn: 108 init1: 108 opt: 122  Z-score: 160.5  bits: 34.7 E(): 0.005
Smith-Waterman score: 122; 30.9% identity (64.7% similar) in 68 aa overlap (13-80:31-98)

                                 10        20        30        40        50        60        70        80        90       
                         GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ
                                     .:.  :: . .:. . ..:  ::..  : :. :..:. :. .:::.. . .::. : .  : .  : :                 
gnl|md MGSSHHHHHHSSGLVPRGSHMQKEGPEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSKPW 
               10        20        30        40        50        60        70        80        90       100       110     

entry 27154, entity entity_1                                                                                        (114 aa)
 initn: 108 init1: 108 opt: 122  Z-score: 160.5  bits: 34.7 E(): 0.005
Smith-Waterman score: 122; 30.9% identity (64.7% similar) in 68 aa overlap (13-80:31-98)

                                 10        20        30        40        50        60        70        80        90       
                         GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ
                                     .:.  :: . .:. . ..:  ::..  : :. :..:. :. .:::.. . .::. : .  : .  : :                 
gnl|md MGSSHHHHHHSSGLVPRGSHMQKEGPEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSKPW 
               10        20        30        40        50        60        70        80        90       100       110     

entry 19766, entity Snu17p                                                                                          (118 aa)
 initn: 103 init1: 103 opt: 122  Z-score: 160.3  bits: 34.7 E(): 0.0051
Smith-Waterman score: 122; 23.5% identity (62.2% similar) in 98 aa overlap (1-97:1-96)

               10        20        30        40        50        60        70         80        90                             
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPI-IDGRKANVNLAYLGAKPRTNVQ                      
       ::::..    . :..:.:  . ..  .   : ..:   ....  :.:: .:.:.... ..:. :.  :  . : . : ::  ... ..   .:. ..:                      
gnl|md GAMGNEYKDNAYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNLNGFKIGGRALKIDHTFY--RPKRSLQKYYEAVKEELDRDIVSKNNAEK
               10        20        30        40        50        60        70        80          90       100       110        

entry 25443, entity Snu17p                                                                                          (118 aa)
 initn: 103 init1: 103 opt: 122  Z-score: 160.3  bits: 34.7 E(): 0.0051
Smith-Waterman score: 122; 23.5% identity (62.2% similar) in 98 aa overlap (1-97:1-96)

               10        20        30        40        50        60        70         80        90                             
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPI-IDGRKANVNLAYLGAKPRTNVQ                      
       ::::..    . :..:.:  . ..  .   : ..:   ....  :.:: .:.:.... ..:. :.  :  . : . : ::  ... ..   .:. ..:                      
gnl|md GAMGNEYKDNAYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNLNGFKIGGRALKIDHTFY--RPKRSLQKYYEAVKEELDRDIVSKNNAEK
               10        20        30        40        50        60        70        80          90       100       110        

entry 25442, entity Snu17p                                                                                          (118 aa)
 initn: 103 init1: 103 opt: 122  Z-score: 160.3  bits: 34.7 E(): 0.0051
Smith-Waterman score: 122; 23.5% identity (62.2% similar) in 98 aa overlap (1-97:1-96)

               10        20        30        40        50        60        70         80        90                             
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPI-IDGRKANVNLAYLGAKPRTNVQ                      
       ::::..    . :..:.:  . ..  .   : ..:   ....  :.:: .:.:.... ..:. :.  :  . : . : ::  ... ..   .:. ..:                      
gnl|md GAMGNEYKDNAYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNLNGFKIGGRALKIDHTFY--RPKRSLQKYYEAVKEELDRDIVSKNNAEK
               10        20        30        40        50        60        70        80          90       100       110        

entry 27157, entity entity_1                                                                                        (114 aa)
 initn: 107 init1: 107 opt: 121  Z-score: 159.3  bits: 34.5 E(): 0.0058
Smith-Waterman score: 121; 30.9% identity (63.2% similar) in 68 aa overlap (13-80:31-98)

                                 10        20        30        40        50        60        70        80        90       
                         GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ
                                     .:.  :: . .:. . ..:  ::..  : :  :..:. :. .:::.. . .::. : .  : .  : :                 
gnl|md MGSSHHHHHHSSGLVPRGSHMQKEGPEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVAIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSKPW 
               10        20        30        40        50        60        70        80        90       100       110     

entry 27153, entity entity_1                                                                                        (114 aa)
 initn: 107 init1: 107 opt: 121  Z-score: 159.3  bits: 34.5 E(): 0.0058
Smith-Waterman score: 121; 30.9% identity (63.2% similar) in 68 aa overlap (13-80:31-98)

                                 10        20        30        40        50        60        70        80        90       
                         GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ
                                     .:.  :: . .:. . ..:  ::..  : :  :..:. :. .:::.. . .::. : .  : .  : :                 
gnl|md MGSSHHHHHHSSGLVPRGSHMQKEGPEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVAIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSKPW 
               10        20        30        40        50        60        70        80        90       100       110     

entry 25497, entity RRM1                                                                                            (95 aa)
 initn: 105 init1: 105 opt: 120  Z-score: 159.3  bits: 34.2 E(): 0.0058
Smith-Waterman score: 120; 36.2% identity (69.0% similar) in 58 aa overlap (13-70:22-77)

                        10        20        30        40        50        60        70        80        90       
                GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ
                            ::::.: : .. . : :.: :.: . .: .::.:. .  ::.: : . .  ...:: .                           
gnl|md GSARELDSTYEEKVNRNYSNSIFVGNLTYDSTPEDLTEFFSQIGKVVRADIITSRGHH--RGMGTVEFTNSDDVDRAIRQYDGAFFMDRKIFVRQDN         
               10        20        30        40        50          60        70        80        90              

entry 16236, entity Bruno_RRM3+                                                                                     (118 aa)
 initn: 106 init1: 106 opt: 121  Z-score: 159.1  bits: 34.5 E(): 0.0059
Smith-Waterman score: 121; 33.8% identity (58.8% similar) in 68 aa overlap (13-80:43-110)

                                             10        20        30        40        50        60        70        80        90
                                     GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGA
                                                 .:.  :: . .:  :   :  ::..  : :. :..:. :. .:::.. .  ::. : :  : .  : :          
gnl|md AAGLPQFGSASALSTSPLASVALSAAAAAAAGKQIEGPEGCNLFIYHLPQEFTDTDLASTFLPFGNVISAKVFIDKQTSLSKCFGFVSFDNPDSAQVAIKAMNGFQVGTKRLKVQLKK  
               10        20        30        40        50        60        70        80        90       100       110          

              
       KPRTNVQ

entry 19500, entity HUR_RRM3_S318D_mutant                                                                           (124 aa)
 initn: 120 init1: 120 opt: 121  Z-score: 158.8  bits: 34.5 E(): 0.0062
Smith-Waterman score: 121; 35.3% identity (57.4% similar) in 68 aa overlap (13-80:44-111)

                                              10        20        30        40        50        60        70        80         
                                      GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLG
                                                  ::. .:   ...  : ..:  :: . .. :: : ::.: .:.::::: .   :  :  . :    : :         
gnl|md MKHHHHHHPMSDYDIPTTEISGRENLYFQSGSEFPAETPSGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVDFKTN
               10        20        30        40        50        60        70        80        90       100       110       120

      90       
       AKPRTNVQ
               
gnl|md KSHK    
               

entry 19494, entity HUR_RRM3_polypeptide                                                                            (124 aa)
 initn: 120 init1: 120 opt: 121  Z-score: 158.8  bits: 34.5 E(): 0.0062
Smith-Waterman score: 121; 35.3% identity (57.4% similar) in 68 aa overlap (13-80:44-111)

                                              10        20        30        40        50        60        70        80         
                                      GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLG
                                                  ::. .:   ...  : ..:  :: . .. :: : ::.: .:.::::: .   :  :  . :    : :         
gnl|md MKHHHHHHPMSDYDIPTTEISGRENLYFQSGSEFPAETPSGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVSFKTN
               10        20        30        40        50        60        70        80        90       100       110       120

      90       
       AKPRTNVQ
               
gnl|md KSHK    
               

entry 4085, entity Sex-lethal protein RNA binding domain 2                                                          (97 aa)
 initn:  42 init1:  42 opt: 119  Z-score: 158.0  bits: 34.0 E(): 0.0069
Smith-Waterman score: 119; 30.3% identity (60.6% similar) in 66 aa overlap (11-76:14-79)

                  10        20        30        40        50        60        70        80        90       
          GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ
                    :...: .::   .:  :   : ..:.: .  .. :. : . :: .:: .. :  :..: .  : .:                     
gnl|md MSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLAEEHGK   
               10        20        30        40        50        60        70        80        90          

entry 15528, entity ePABP2-trp                                                                                      (124 aa)
 initn:  52 init1:  52 opt: 119  Z-score: 156.4  bits: 34.1 E(): 0.0083
Smith-Waterman score: 119; 22.5% identity (66.2% similar) in 71 aa overlap (13-83:39-109)

                                         10        20        30        40        50        60        70        80        90    
                                 GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRT
                                             ..::.. : .. . :. .: . :.:.. ... :. . . .::... . .: :.. :    . .. ::  .:           
gnl|md AIAPCMQTTHSKMTAGAYTEGPPQPLSAEEKKEIDKRSVYVGNVDYGSTAQDLEAHFSSCGSINRITILCDKFSGHPKGYAYIEFAERNSVDAAVAMDETVFRGRTIKVLPKRTNMPGIS
               10        20        30        40        50        60        70        80        90       100       110       120

           
       NVQ 
           
gnl|md STDR
           

entry 25047, entity RRM                                                                                             (93 aa)
 initn: 103 init1: 103 opt: 114  Z-score: 152.4  bits: 32.9 E(): 0.014
Smith-Waterman score: 114; 23.9% identity (60.9% similar) in 92 aa overlap (1-91:1-92)

               10        20        30        40        50        60        70         80        90       
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPI-IDGRKANVNLAYLGAKPRTNVQ
       ::::..    . :..:.:  . ..  .   : ..:   ....  :.:: .:.:.... ..:. :.  :  . : . : ::  ... ..   :      
gnl|md GAMGNEYKDNAYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNLNGFKIGGRALKIDHTFYRPKR     
               10        20        30        40        50        60        70        80        90        

entry 19922, entity TDP-43_RRM2                                                                                     (76 aa)
 initn:  69 init1:  69 opt: 109  Z-score: 147.8  bits: 31.8 E(): 0.025
Smith-Waterman score: 114; 27.4% identity (58.3% similar) in 84 aa overlap (12-95:3-76)

               10        20        30        40        50        60        70        80        90       
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ
                  :.:::      ..  :.:.: :.::. .. .      .  :...:::. :   :.  : . . :: : .....    .:.:. :  
gnl|md          MRKVFVGRCTEDMTEDELREFFSQYGDVMDVFI-----PKPFRAFAFVTFADDQIAQSLCGE-DLIIKGISVHIS----NAEPKHN  
                        10        20        30             40        50         60            70        

entry 25800, entity PfSR1-RRM1                                                                                      (89 aa)
 initn:  71 init1:  71 opt: 109  Z-score: 146.8  bits: 31.8 E(): 0.029
Smith-Waterman score: 109; 25.6% identity (67.9% similar) in 78 aa overlap (11-87:11-85)

               10        20        30        40        50        60        70         80        90       
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPI-IDGRKANVNLAYLGAKPRTNVQ
                 ..:.::.:: :.:.. ... :...:.: .  :   ..: .. ...:. ..:  .:  : :. .   ..: :  :.. .          
gnl|md GSHMVIRESVSRIYVGNLPSHVSSRDVENEFRKYGNILKCDV---KKTVSGAAFAFIEFEDARDAADAIKEKDGCDFEGNKLRVEVPFNARE      
               10        20        30        40           50        60        70        80               

entry 25650, entity PfSR1-RRM1                                                                                      (89 aa)
 initn:  71 init1:  71 opt: 109  Z-score: 146.8  bits: 31.8 E(): 0.029
Smith-Waterman score: 109; 25.6% identity (67.9% similar) in 78 aa overlap (11-87:11-85)

               10        20        30        40        50        60        70         80        90       
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPI-IDGRKANVNLAYLGAKPRTNVQ
                 ..:.::.:: :.:.. ... :...:.: .  :   ..: .. ...:. ..:  .:  : :. .   ..: :  :.. .          
gnl|md GSHMVIRESVSRIYVGNLPSHVSSRDVENEFRKYGNILKCDV---KKTVSGAAFAFIEFEDARDAADAIKEKDGCDFEGNKLRVEVPFNARE      
               10        20        30        40           50        60        70        80               

entry 16425, entity rna15p                                                                                          (84 aa)
 initn:  88 init1:  88 opt: 107  Z-score: 144.8  bits: 31.4 E(): 0.037
Smith-Waterman score: 107; 23.0% identity (63.9% similar) in 61 aa overlap (13-73:7-67)

               10        20        30        40        50        60        70        80        90       
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ
                   ...:..::  ... . .   . : . .  .. : .: .:.::.:. ..:  :.  : .. :                        
gnl|md       NPPSRVVYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESSASAVRNLNGYQLGSRFLKCGYSSNS       
                     10        20        30        40        50        60        70        80           

entry 26948, entity SART3_RRM2                                                                                      (78 aa)
 initn:  47 init1:  47 opt: 104  Z-score: 141.7  bits: 30.7 E(): 0.055
Smith-Waterman score: 104; 26.3% identity (70.2% similar) in 57 aa overlap (12-68:3-58)

               10        20        30        40        50        60        70        80        90       
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ
                  :.:..:::.  . . :.:  .  : ...  ..:.: . : .: ..: ......: .:                             
gnl|md          KHKLFISGLPFSCTKEELEEICKAHGTVKDLRLVTNR-AGKPKGLAYVEYENESQASQAVMKMDGMTIKENIIKVAISN         
                        10        20        30         40        50        60        70                 

entry 16646, entity RBD1,2                                                                                          (180 aa)
 initn:  90 init1:  53 opt: 107  Z-score: 140.1  bits: 31.6 E(): 0.068
Smith-Waterman score: 107; 29.3% identity (65.9% similar) in 82 aa overlap (13-93:96-169)

                                                               10        20        30        40        50        60        70  
                                                       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDP
                                                                   ... .:::....  :.: ::   :  :  ...  .  ::.: ... .: .:.::.. .. 
gnl|md DLAVVDVRIGMTRKFGYVDFESAEDLEKALELTGLKVFGNEIKLEKPKGKDSKKERDARTLLAKNLPYKVTQDELKEVFE---DAAEIRLVSKDG--KSKGIAYIEFKTEADAEKTFEEK
          40        50        60        70        80        90       100       110          120         130       140       150

              80        90              
       NPI-IDGRKANVNLAYLGAKPRTNVQ       
       .   ::::  ...: : : .:.           
gnl|md QGTEIDGR--SISLYYTG-EPKGEGLEHHHHHH
                160        170       180

entry 11366, entity spliceosomal protein p14, RNA recognition motif                                                 (87 aa)
 initn:  73 init1:  73 opt: 103  Z-score: 139.9  bits: 30.5 E(): 0.07
Smith-Waterman score: 103; 28.1% identity (68.4% similar) in 57 aa overlap (13-69:15-68)

                 10        20        30        40        50        60        70        80        90       
         GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ
                     ... .:::. . . ... : ..: :..  :    :: ..:: ..:...:  .:. ::                            
gnl|md GRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRV---GNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYN         
               10        20        30        40           50        60        70        80                

entry 19642, entity entity                                                                                          (152 aa)
 initn:  60 init1:  60 opt: 105  Z-score: 138.8  bits: 31.1 E(): 0.081
Smith-Waterman score: 105; 28.6% identity (64.3% similar) in 56 aa overlap (13-68:15-70)

                 10        20        30        40        50        60        70        80        90                            
         GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ                     
                     .:   :  .   . :.:.:   : .... .:.:::...:.: ..: . : .:.  :                                                  
gnl|md GHMNLTPEERDARTVFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQRVLGVPIIVQASQAEKNRRRSKGIAYVEFVDVSSVPLAIGLTGQ
               10        20        30        40        50        60        70        80        90       100       110       120

gnl|md RVLGVPIIVQASQAEKNRVPIIVQASQAEKNR
              130       140       150  

entry 11523, entity Nrd1_RRM2                                                                                       (97 aa)
 initn:  93 init1:  93 opt:  99  Z-score: 134.5  bits: 29.7 E(): 0.14
Smith-Waterman score: 99; 30.0% identity (61.4% similar) in 70 aa overlap (13-80:21-84)

                       10        20        30        40        50        60        70          80        90       
               GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKD-P-NPIIDGRKANVNLAYLGAKPRTNVQ
                           .:.:.::   ..  ..: .: :: :..  ..:.::       .:: . . :.: .: .. : ::  . :.                 
gnl|md NSASNSSVLLAVQQSGACRNVFLGNLPNGITEDEIREDLEPFGPIDQIKIVTERNI------AFVHFLNIAAAIKAVQELPLNPKWSKRRIYYGRDRCAVGLK    
               10        20        30        40        50              60        70        80        90           

entry 4863, entity NUCLEOLIN RBD2                                                                                   (96 aa)
 initn:  53 init1:  53 opt:  97  Z-score: 132.2  bits: 29.2 E(): 0.19
Smith-Waterman score: 97; 28.8% identity (63.8% similar) in 80 aa overlap (13-91:19-91)

                     10        20        30        40        50        60        70         80        90       
             GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPI-IDGRKANVNLAYLGAKPRTNVQ
                         ... .: .. ..  :.: ::   :  :  .... .  ::.: ... .:..:.::.  .. .   ::::  .:.: : : :      
gnl|md SHMLEDPCTSKKVRAARTLLAKNLSFNITEDELKEVFE---DALEIRLVSQDG--KSKGIAYIEFKSEADAEKNLEEKQGAEIDGR--SVSLYYTGEKGGTRG 
               10        20        30           40        50          60        70        80          90       

entry 26912, entity Nrd1                                                                                            (177 aa)
 initn:  93 init1:  93 opt:  99  Z-score: 130.8  bits: 29.9 E(): 0.22
Smith-Waterman score: 99; 30.0% identity (61.4% similar) in 70 aa overlap (13-80:101-164)

                                                               10        20        30        40        50        60        70  
                                                       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKD-
                                                                   .:.:.::   ..  ..: .: :: :..  ..:.::       .:: . . :.: .: .. 
gnl|md EKNCAFISFLDPSHATAFFQDAALKRLTIRGTEVKVGWGKNSASNSSVLLAVQQSGACRNVFLGNLPNGITEDEIREDLEPFGPIDQIKIVTERNI------AFVHFLNIAAAIKAVQEL
               50        60        70        80        90       100       110       120       130             140       150    

               80        90       
       P-NPIIDGRKANVNLAYLGAKPRTNVQ
       : ::  . :.                 
gnl|md PLNPKWSKRRIYYGRDRCAVGLK    
          160       170           

entry 19252, entity RBM7                                                                                            (101 aa)
 initn:  59 init1:  59 opt:  95  Z-score: 129.6  bits: 28.8 E(): 0.26
Smith-Waterman score: 95; 27.0% identity (64.9% similar) in 74 aa overlap (13-85:19-91)

                     10        20        30        40        50        60        70         80        90       
             GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPI-IDGRKANVNLAYLGAKPRTNVQ
                         .:::.:  ..... : : :.: : . .. .  :..  : . ..::..: ..:.  : .  : : . ::  ....            
gnl|md GSEFELRRQQALAEADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDG-KPKQFAFVNFKHEVSVPYAMNLLNGIKLYGRPIKIQFRSGSSHAPQD  
               10        20        30        40        50         60        70        80        90       100   

entry 10077, entity RNA recognition motif                                                                           (104 aa)
 initn:  49 init1:  49 opt:  94  Z-score: 128.2  bits: 28.6 E(): 0.31
Smith-Waterman score: 94; 21.6% identity (58.0% similar) in 88 aa overlap (1-86:4-91)

                    10        20        30        40        50        60        70        80        90         
          GAMGSR--DTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ  
          :. :::   .     :.:.::: .......:.:. ..     .     : .. .:.:.. ..:  :   : .  .  . ...  :..:             
gnl|md GSSGSSGSRLPKSPPYTAFLGNLPYDVTEESIKEFFRGLNISAVRLPREPSNPERLKGFGYAEFEDLDSLLSALSLNEESLGNKRIRVDVADQAQDKDSGPSSG
               10        20        30        40        50        60        70        80        90       100    

entry 11563, entity The_first_RNA_recognition_motif_domain                                                          (114 aa)
 initn:  62 init1:  62 opt:  94  Z-score: 127.7  bits: 28.6 E(): 0.33
Smith-Waterman score: 94; 30.0% identity (60.0% similar) in 70 aa overlap (1-66:4-66)

                  10        20        30        40        50            60        70        80        90                       
          GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKS----RGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ                
          :. :::     :.::::::   ..  .   :..:: .  .:    .  .::    .::.:. .....:..                                               
gnl|md GSSGSSGSR-----KVFVGGLPPDIDEDEITASFRRFGPL--VVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACLEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDSGPSS
                    10        20        30          40        50        60        70        80        90       100       110   

gnl|md G
        

entry 26922, entity MEC-8_RRM1                                                                                      (100 aa)
 initn:  82 init1:  49 opt:  93  Z-score: 127.3  bits: 28.4 E(): 0.35
Smith-Waterman score: 93; 31.0% identity (62.0% similar) in 71 aa overlap (1-70:1-68)

               10        20        30        40         50        60        70        80        90            
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVV-ITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ     
       :::.:.      .::.:::. .. . :.  :.     : :.. .:..: . .   ::::. .. .:. : :                                
gnl|md GAMASQ---VRTLFVSGLPMDAKPRELYLLFRGARGYEGALLKMTSKNGKPTSPVGFVTFLSQQDAQDARKMLQGVRFDPEAAQVLRLELAKSNTKVARPKQS
                  10        20        30        40        50        60        70        80        90       100

entry 17589, entity RRM3                                                                                            (93 aa)
 initn:  60 init1:  60 opt:  90  Z-score: 124.2  bits: 27.7 E(): 0.52
Smith-Waterman score: 90; 27.3% identity (67.5% similar) in 77 aa overlap (12-86:5-81)

               10        20         30        40        50         60        70        80        90        
       GAMGSRDTMFTKIFVGGLPYHTSDKTL-HEYFEQFGDIEEAVVITDRNTQK-SRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ 
                  .:.. .:  .  :..: .: :: ::.::.  . . .. .. .   .:...... ::::: .    .. .:. .:.::            
gnl|md        MEGREIMIRNLSTELLDENLLRESFEGFGSIEKINIPAGQKEHSFNNCCAFMVFENKDSAERALQMNRSLLGNREISVSLADKKPLWHHHHHH
                      10        20        30        40        50        60        70        80        90   

entry 19777, entity CPEB4RRM12                                                                                      (203 aa)
 initn:  62 init1:  62 opt:  94  Z-score: 124.1  bits: 28.8 E(): 0.53
Smith-Waterman score: 94; 29.6% identity (55.6% similar) in 81 aa overlap (4-79:5-82)

                10         20        30        40        50            60        70        80        90                        
        GAMGSRDTMFT-KIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKS----RGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ                 
           : :   .. :.::::::   ..  .   :..:: .   :    .  .::    .::.:. ..:..:.. :  :     ::.                                   
gnl|md SHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPL--IVDWPHKAESKSYFPPKGYAFLLFQDESSVQ-ALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPL
               10        20        30          40        50        60        70         80        90       100       110       

gnl|md DPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVL
       120       130       140       150       160       170       180       190       200   

entry 19776, entity CPEB4RRM12                                                                                      (203 aa)
 initn:  62 init1:  62 opt:  94  Z-score: 124.1  bits: 28.8 E(): 0.53
Smith-Waterman score: 94; 29.6% identity (55.6% similar) in 81 aa overlap (4-79:5-82)

                10         20        30        40        50            60        70        80        90                        
        GAMGSRDTMFT-KIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKS----RGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ                 
           : :   .. :.::::::   ..  .   :..:: .   :    .  .::    .::.:. ..:..:.. :  :     ::.                                   
gnl|md SHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPL--IVDWPHKAESKSYFPPKGYAFLLFQDESSVQ-ALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPL
               10        20        30          40        50        60        70         80        90       100       110       

gnl|md DPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVL
       120       130       140       150       160       170       180       190       200   

entry 19320, entity Taf15                                                                                           (97 aa)
 initn:  57 init1:  57 opt:  88  Z-score: 121.6  bits: 27.3 E(): 0.73
Smith-Waterman score: 88; 31.5% identity (54.8% similar) in 73 aa overlap (4-68:1-73)

               10        20        30        40                50        60        70        80        90       
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAV--------VITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ
          ::. .  . ::: ::   .:   . :.:.:.: :.           . ::..: : .: . :.. :  ::. :                             
gnl|md    GSHMSDNNTIFVQGLGEGVSTDQVGEFFKQIGIIKTNKKTGKPMINLYTDKDTGKPKGEATVSFDDPPSAKAAIDWFDGKEFHGNIIKVSFATRRPE     
                  10        20        30        40        50        60        70        80        90            

entry 17508, entity HR6430A                                                                                         (99 aa)
 initn: 105 init1:  62 opt:  88  Z-score: 121.5  bits: 27.3 E(): 0.74
Smith-Waterman score: 88; 32.8% identity (59.4% similar) in 64 aa overlap (13-68:16-79)

                  10        20        30        40                50        60        70        80        90       
          GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAV--------VITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ
                      ::: ::  ... ... .::.:.: :.           . :::.: : .: . :.. :  ::. :                             
gnl|md MGHHHHHHSHSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFAT         
               10        20        30        40        50        60        70        80        90                  

entry 6930, entity snRNP protein                                                                                    (104 aa)
 initn:  44 init1:  44 opt:  88  Z-score: 121.2  bits: 27.3 E(): 0.77
Smith-Waterman score: 88; 39.1% identity (65.2% similar) in 46 aa overlap (25-70:25-67)

               10        20        30        40        50        60        70        80        90                 
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ          
                               :.:.  : :::.: . :..   .: : :: .:: .:. .::  : .                                     
gnl|md MEMLPNQTIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVAL---KTLKMRGQAFVIFKEIGSASNALRTMQGFPFYDKPMQIAYSKSDSDIVAKIKGTFKERPKK
               10        20        30        40           50        60        70        80        90       100    

entry 17635, entity FUS/TLS RRM domain                                                                              (108 aa)
 initn: 105 init1:  62 opt:  88  Z-score: 121.0  bits: 27.3 E(): 0.79
Smith-Waterman score: 88; 32.8% identity (59.4% similar) in 64 aa overlap (13-68:10-73)

               10        20        30        40                50        60        70        80        90             
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAV--------VITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ      
                   ::: ::  ... ... .::.:.: :.           . :::.: : .: . :.. :  ::. :                                   
gnl|md    EQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGG
                  10        20        30        40        50        60        70        80        90       100        

entry 7383, entity Nucleolar_protein_3                                                                              (74 aa)
 initn:  60 init1:  60 opt:  86  Z-score: 121.0  bits: 26.8 E(): 0.79
Smith-Waterman score: 86; 26.2% identity (62.3% similar) in 61 aa overlap (11-71:5-57)

               10        20        30        40        50        60        70        80        90       
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ
                 :..::  .:  .... :.: :  :: ..:. ...        :..:: ...  :: .: ..                          
gnl|md       ELSNTRLFVRPFPLDVQESELNEIFGPFGPMKEVKILN--------GFAFVEFEEAESAAKAIEEVHGKSFANQPLEVVYSK         
                     10        20        30                40        50        60        70             

entry 18829, entity RRM_domain                                                                                      (103 aa)
 initn:  61 init1:  61 opt:  87  Z-score: 120.1  bits: 27.1 E(): 0.89
Smith-Waterman score: 87; 28.6% identity (60.7% similar) in 56 aa overlap (13-68:19-68)

                     10        20        30        40        50        60        70        80        90             
             GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ      
                         .. ::.    ... ... :  ::.: :  :. :.      ::.:: .... :: .:                                   
gnl|md SGSSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDK------GYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQI
               10        20        30        40        50              60        70        80        90       100   

entry 16244, entity Prp24-RRM23                                                                                     (186 aa)
 initn:  60 init1:  60 opt:  90  Z-score: 119.9  bits: 27.9 E():  0.9
Smith-Waterman score: 90; 27.3% identity (67.5% similar) in 77 aa overlap (12-86:98-174)

                                                                10        20         30        40        50         60         
                                                        GAMGSRDTMFTKIFVGGLPYHTSDKTL-HEYFEQFGDIEEAVVITDRNTQK-SRGYGFVTMKDRASAERAC
                                                                   .:.. .:  .  :..: .: :: ::.::.  . . .. .. .   .:...... ::::: 
gnl|md SLRFNTSRRFAYIDVTSKEDARYCVEKLNGLKIEGYTLVTKVSNPLEKSKRTDSATLEGREIMIRNLSTELLDENLLRESFEGFGSIEKINIPAGQKEHSFNNCCAFMVFENKDSAERAL
        40        50        60        70        80        90       100       110       120       130       140       150       

      70        80        90        
       KDPNPIIDGRKANVNLAYLGAKPRTNVQ 
       .    .. .:. .:.::            
gnl|md QMNRSLLGNREISVSLADKKPLEHHHHHH
       160       170       180      

entry 16243, entity Prp24-RRM23                                                                                     (186 aa)
 initn:  60 init1:  60 opt:  90  Z-score: 119.9  bits: 27.9 E():  0.9
Smith-Waterman score: 90; 27.3% identity (67.5% similar) in 77 aa overlap (12-86:98-174)

                                                                10        20         30        40        50         60         
                                                        GAMGSRDTMFTKIFVGGLPYHTSDKTL-HEYFEQFGDIEEAVVITDRNTQK-SRGYGFVTMKDRASAERAC
                                                                   .:.. .:  .  :..: .: :: ::.::.  . . .. .. .   .:...... ::::: 
gnl|md SLRFNTSRRFAYIDVTSKEDARYCVEKLNGLKIEGYTLVTKVSNPLEKSKRTDSATLEGREIMIRNLSTELLDENLLRESFEGFGSIEKINIPAGQKEHSFNNCCAFMVFENKDSAERAL
        40        50        60        70        80        90       100       110       120       130       140       150       

      70        80        90        
       KDPNPIIDGRKANVNLAYLGAKPRTNVQ 
       .    .. .:. .:.::            
gnl|md QMNRSLLGNREISVSLADKKPLEHHHHHH
       160       170       180      

entry 15485, entity Npl3_RRM1                                                                                       (108 aa)
 initn:  60 init1:  60 opt:  86  Z-score: 118.6  bits: 26.9 E():  1.1
Smith-Waterman score: 86; 26.2% identity (62.3% similar) in 61 aa overlap (11-71:32-84)

                                    10        20        30        40        50        60        70        80        90       
                            GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ
                                      :..::  .:  .... :.: :  :: ..:. ...        :..:: ...  :: .: ..                          
gnl|md MGSSHHHHHHSSGLVPRGSHMHHRQEGELSNTRLFVRPFPLDVQESELNEIFGPFGPMKEVKILN--------GFAFVEFEEAESAAKAIEEVHGKSFANQPLEVVYSKLPAKRYR  
               10        20        30        40        50        60                70        80        90       100          

entry 19561, entity Taf-RRM-RanBP                                                                                   (162 aa)
 initn:  31 init1:  31 opt:  88  Z-score: 118.4  bits: 27.4 E():  1.1
Smith-Waterman score: 88; 31.5% identity (54.8% similar) in 73 aa overlap (4-68:1-73)

               10        20        30        40                50        60        70        80        90                      
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAV--------VITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ               
          ::. .  . ::: ::   .:   . :.:.:.: :.           . ::..: : .: . :.. :  ::. :                                            
gnl|md    GSHMSDNNTIFVQGLGEGVSTDQVGEFFKQIGIIKTNKKTGKPMINLYTDKDTGKPKGEATVSFDDPPSAKAAIDWFDGKEFHGNIIKVSFATRRPEFMRGGGSGGGRRGRGGYRGR
                  10        20        30        40        50        60        70        80        90       100       110       

gnl|md GGFQGRGGDPKSGDWVCPNPSCGNMNFARRNSCNQCNEPRPEDSR
       120       130       140       150       160  

entry 19298, entity entity                                                                                          (93 aa)
 initn:  89 init1:  57 opt:  83  Z-score: 116.0  bits: 26.2 E():  1.5
Smith-Waterman score: 83; 32.8% identity (56.2% similar) in 64 aa overlap (13-75:8-66)

               10        20        30        40         50        60        70        80        90            
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVV-ITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ     
                   .::.:::   . . :.  :. :   : ... .: :     .  ::: . .::.:: : .  : :                           
gnl|md      MEEEVRTLFVSGLPVDIKPRELYLLFRPFKGYEGSLIKLTAR-----QPVGFVIFDSRAGAEAAKNALNGIRFDPENPQTLRLEFAKANTKMAKSKLE
                    10        20        30        40             50        60        70        80        90   

entry 27055, entity RBM_10RRM2                                                                                      (89 aa)
 initn:  63 init1:  63 opt:  82  Z-score: 115.1  bits: 26.0 E():  1.7
Smith-Waterman score: 82; 32.0% identity (60.0% similar) in 50 aa overlap (42-86:37-86)

               10        20        30        40        50        60        70             80        90       
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACK-----DPNPIIDGRKANVNLAYLGAKPRTNVQ
                                                :: :..:: .::..:. ..  . : .  .      :   :::.  ::..:           
gnl|md      GHMDTIILRNLNPHSTMDSILGALAPYAVLSSSNVRVIKDKQTQLNRGFAFIQLSTIVEAAQLLQILQALHPPLTIDGKTINVEFAKGS        
                    10        20        30        40        50        60        70        80                 

entry 4772, entity RNA-binding protein with multiple splicing                                                       (111 aa)
 initn:  87 init1:  57 opt:  83  Z-score: 114.9  bits: 26.2 E():  1.7
Smith-Waterman score: 83; 31.7% identity (58.7% similar) in 63 aa overlap (13-75:26-84)

                            10        20        30        40        50        60        70        80        90            
                    GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ     
                                .::.:::   . . :.  :. :   : ...   . :.: .  :::.. .:. :: : .  : :                           
gnl|md MNNGGKAEKENTPSEANLQEEEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLI---KLTSK-QPVGFVSFDSRSEAEAAKNALNGIRFDPEIPQTLRLEFAKANTKMAKNKLV
               10        20        30        40        50           60         70        80        90       100       110 

entry 18905, entity entity                                                                                          (131 aa)
 initn:  65 init1:  65 opt:  82  Z-score: 112.7  bits: 26.1 E():  2.3
Smith-Waterman score: 82; 34.5% identity (63.6% similar) in 55 aa overlap (42-91:57-109)

                              10        20        30        40        50        60             70        80        90          
                      GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAE-----RACKDPNPIIDGRKANVNLAYLGAKPRTNVQ   
                                                               :: :..:: .::..:. ..   .:.     .: . :  : ::.  ::..:  :.:         
gnl|md QAQGVLASQALSQGSEPSSENANDTIILRNLNPHSTMDSILGALAPYAVLSSSNVRVIKDKQTQLNRGFAFIQLSTIEAAQLLQILQALHPPLTI-DGKTINVEFAK-GSKRDMASNEGS
               10        20        30        40        50        60        70        80        90        100        110        

gnl|md RISAASVASTAIA
      120       130 

entry 18678, entity entity                                                                                          (91 aa)
 initn:  58 init1:  58 opt:  80  Z-score: 112.6  bits: 25.5 E():  2.3
Smith-Waterman score: 80; 20.3% identity (59.5% similar) in 79 aa overlap (18-95:9-87)

               10        20        30         40        50        60        70        80        90         
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFG-DIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ  
                        ::  ...  ..  ... : . .:. .. .... .:::..:: ..   .: :  .  .  ..    .:.. :   ::. :    
gnl|md          SNIVMLRMLPQAATEDDIRGQLQSHGVQAREVRLMRNKSSGQSRGFAFVEFSHLQDATRWMEANQHSLNILGQKVSMHYSDPKPKINEDWL
                        10        20        30        40        50        60        70        80        90 

entry 18017, entity entity                                                                                          (95 aa)
 initn:  51 init1:  51 opt:  80  Z-score: 112.4  bits: 25.5 E():  2.4
Smith-Waterman score: 80; 30.0% identity (64.0% similar) in 50 aa overlap (42-86:43-92)

                10        20        30        40        50        60        70             80        90       
        GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACK-----DPNPIIDGRKANVNLAYLGAKPRTNVQ
                                                 .: :..::..::..:: ...  .: .  .      :   :::.  .:..:           
gnl|md MGHHHHHHMDTIILRNIAPHTVVDSIMTALSPYASLAVNNIRLIKDKQTQQNRGFAFVQLSSAMDASQLLQILQSLHPPLKIDGKTIGVDFAKSA        
               10        20        30        40        50        60        70        80        90             

entry 34140, entity entity_1                                                                                        (179 aa)
 initn:  79 init1:  51 opt:  82  Z-score: 110.8  bits: 26.2 E():  2.9
Smith-Waterman score: 82; 25.8% identity (63.6% similar) in 66 aa overlap (13-78:52-109)

                                                      10        20        30        40        50        60        70        80 
                                              GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKA
                                                          .:.::.: . ..  : . .. :.... .:....     :: ..:: . .:  :: . .. :   ::   
gnl|md SIGAPNTTFGTNNHHLYPDELNVSNNPHYRPKPVSYDSTLPPDHIKVYSRTLFIGGVPLNMKEWDLANVLKPFAEVQ-SVILNN-----SRKHAFVKVYSRHEAENVLQNFNK--DGALP
               10        20        30        40        50        60        70         80             90       100         110  

              90                                                          
       NVNLAYLGAKPRTNVQ                                                   
                                                                          
gnl|md LRTRWGVGFGPRDCCDYQHGYSIIPMHRLTDADKKWSVSAQWGGTSGQPLVTGIVFEEPDIIVGEGV
            120       130       140       150       160       170         

entry 19232, entity entity                                                                                          (185 aa)
 initn:  79 init1:  51 opt:  82  Z-score: 110.6  bits: 26.2 E():    3
Smith-Waterman score: 82; 25.8% identity (63.6% similar) in 66 aa overlap (13-78:35-92)

                                     10        20        30        40        50        60        70        80        90        
                             GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ 
                                         .:.::.: . ..  : . .. :.... .:....     :: ..:: . .:  :: . .. :   ::                    
gnl|md PDELNVSNNPHYRPKPVSYDSTLPPDHIKVYSRTLFIGGVPLNMKEWDLANVLKPFAEVQ-SVILNN-----SRKHAFVKVYSRHEAENVLQNFNK--DGALPLRTRWGVGFGPRDCCDY
               10        20        30        40        50        60              70        80        90         100       110  

gnl|md QHGYSIIPMHRLTDADKKWSVSAQWGGTSGQPLVTGIVFEEPDIIVGEGVSSKAISQKMPTDSGRNGPRSGKP
            120       130       140       150       160       170       180     

entry 19013, entity RRM_domain_of_the_hypothetical_protein                                                          (124 aa)
 initn:  56 init1:  56 opt:  76  Z-score: 106.0  bits: 24.8 E():  5.4
Smith-Waterman score: 76; 27.9% identity (52.9% similar) in 68 aa overlap (2-67:2-68)

               10        20        30        40          50        60        70        80        90                            
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVV--ITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ                     
        ..::..   . . : :   ..  : .  :: :::.: : .   . : .:... :: :    .:    :                                                   
gnl|md MSLGSESETGNAVVVFGY-REAITKQILAYFAQFGEILEDLESELGDTETMRTPGYFFQQAPNRRRISREHGRTWTKLTYANHSSYLRALREHGTIYCGAAIGCVPYKHELISELSREGH
               10         20        30        40        50        60        70        80        90       100       110         

gnl|md HHHHH
     120    

entry 19778, entity CPEB1RRM12                                                                                      (213 aa)
 initn:  50 init1:  50 opt:  75  Z-score: 101.5  bits: 24.7 E():  9.6
Smith-Waterman score: 75; 28.4% identity (52.7% similar) in 74 aa overlap (12-78:20-91)

                       10        20        30        40        50             60        70          80        90               
               GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTM-----KDRASAERACK-DP-NPIIDGRKANVNLAYLGAKPRTNVQ        
                          :.:.::.:.  ..  : . :. ::..       : .  .    :.: .     :.  :  .::. :: .:  ::                           
gnl|md MTWSGQLPPRNYKNPIYSCKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKGYVYLVFELEKSVRSLLQACSHDPLSP--DGLSEYYFKMSSRRMRCKEVQVIPWVLAD
               10        20        30        40        50        60        70        80          90       100       110        

gnl|md SNFVRSPSQRLDPSRTVFVGALHGMLNAEALAAILNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVSAAFVEIKTTKFTKKVQIDPYL
      120       130       140       150       160       170       180       190       200       210   

entry 19775, entity CPEB1RRM12                                                                                      (217 aa)
 initn:  50 init1:  50 opt:  75  Z-score: 101.4  bits: 24.7 E():  9.7
Smith-Waterman score: 75; 28.4% identity (52.7% similar) in 74 aa overlap (12-78:20-91)

                       10        20        30        40        50             60        70          80        90               
               GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTM-----KDRASAERACK-DP-NPIIDGRKANVNLAYLGAKPRTNVQ        
                          :.:.::.:.  ..  : . :. ::..       : .  .    :.: .     :.  :  .::. :: .:  ::                           
gnl|md MTWSGQLPPRNYKNPIYSCKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKGYVYLVFELEKSVRSLLQACSHDPLSP--DGLSEYYFKMSSRRMRCKEVQVIPWVLAD
               10        20        30        40        50        60        70        80          90       100       110        

gnl|md SNFVRSPSQRLDPSRTVFVGALHGMLNAEALAAILNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVSAAFVEIKTTKFTKKVQIDPYLEDSL
      120       130       140       150       160       170       180       190       200       210       

entry 11601, entity hESRP1-RRM3                                                                                     (104 aa)
 initn:  31 init1:  31 opt:  71  Z-score: 101.3  bits: 23.6 E():  9.9
Smith-Waterman score: 71; 32.3% identity (56.5% similar) in 62 aa overlap (17-73:14-75)

               10        20        30         40         50        60           70        80        90            
       GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFG-DIEEAVVITDRNTQ-KSRGYGFVTMK--DRA-SAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ     
                       :::: .. . . ... .:. ::.   :    : : .  : .:. ::  :::  : . :.  :                             
gnl|md    MPPTNVRDCIRLRGLPYAATIEDILDFLGEFATDIRTHGVHMVLNHQGRPSGDAFIQMKSADRAFMAAQKCHKKNMKDRYVEVFQCSAEEMNFVLMGGTLNRLE
                  10        20        30        40        50        60        70        80        90       100    



97 residues in 1 query   sequences
1278045 residues in 12628 library sequences
 Tcomplib [35.04] (8 proc)
 start: Wed Jun 20 21:26:40 2018 done: Wed Jun 20 21:26:40 2018
 Total Scan time:  0.110 Total Display time:  0.040

Function used was FASTA [version 35.04 Feb. 20, 2010]